UPSM-264 Real Amateur Married Woman! Second Virgin Loss Av Debut In Sex After 9 Years Urara Chikushi




SHKDCESDGMEMAUKGCHRVNACRAWDSSISMIAAFSDSSSTARSJUFEJULHODVKBINGODATIDSQTEKSBJMEYD
            119 min
Skip Ad

UPSM-264 Real Amateur Married Woman! Second Virgin Loss Av Debut In Sex After 9 Years Urara Chikushi

Views
1.344M
Release date :
2014-05-09
Length :
119 min
Models:
chikushi urara
Categories :
javsingle workhigh visiondebut workcensoredhousewife housewifejavcensored
Director :
shanty yazawa
Studio :
up s
Label :
up s UPSM 264 UPSM264 UPSM h_150upsm00264
Description:
UPSM-264 Real Amateur Married Woman! Second Virgin Loss Av Debut In Sex After 9 Years Urara Chikushi Release date 2014-05-09 Length 119 min h_150upsm00264 Director shanty yazawa Label up s Studio up s ,chikushi urara,censored, high vision, housewife housewife, single work, javcensored, debut work, jav UPSM-264 UPSM264 UPSM




2014-05-09
119 min

UPSM-264 Real Amateur Married Woman! Second Virgin Loss Av Debut In Sex After 9 Years Urara Chikushi

  • chikushi urarasingle workUPSMup sshanty yazawaUPSM-264UPSM264
    • 2021-05-07
    125 min

    FSDSS-220 Twilight Erection When I Saw The Boasting Huge Breasts Girlfriend Who Completely Fell Into The Sadist Director'S Sticky Brainwashing Ntr. Sara Kamiki

  • sara kamikibig titssingle workFSDSSfalenokicchomufaleno starFSDSS-220FSDSS2201fsdss00220
    • 2021-05-21
    120 min

    CAWD-213 M Woman Specialized Deriheru A Younger Female Boss Who Hates Looking Down When You Call Me ... Completely Obeyed And Speared Until An Antibody Was Made Reversal Of Position ● Mayuki Ito

  • maiyuki itocreampiedeepthroatCAWDkawaiizaku araiCAWD-213CAWD213cawd00213
    • 2021-02-26
    100 min

    C-2638 Mature Wife Interview Gonzo [27]

  • amateurmature womanCgogoskoichi takahashicore gogo sC-2638C2638
    • 2021-06-01
    120 min

    NACR-425 My Widow'S Mother-In-Law'S Sex Appeal Munmun'S Yoga Appearance Can Not Suppress My Desire Mai Kitagawa

  • mai kitagawabig titsblowjobNACRplanet plusbito sakurananakuruNACR-425NACR425h-237nacr00425
    • 2021-06-05
    117 min

    LOL-195 B ● Senka “Older Brother ... Forgive Me ...” My Brother Keeps Committing ● My Sister Marina Saito

  • marina saitocreampiebeautiful girlLOLglay zloli senkaLOL-195LOL19512lol00195
    • 2021-06-12
    126 min

    XRL-009 I'Ve Come To Meet My Favorite Chat Girl! ?? Live Streaming Creampie Sex

  • amateurXRLreal worksreal real worksXRL-009XRL009xrl00009
    • 2021-06-12
    170 min

    MKMP-402 I Want To Spend The Night And Continue To Commit Ichika Matsumoto Until The Morning Sun Rises. Ichika Matsumoto

  • ichika matsumotocreampieslutMKMPk m producesamoarimillionMKMP-402MKMP402mkmp00402
    • 2021-06-20
    120 min

    GIGL-652 Picking Up A Married Woman Picking Up A Wife Who Seems To Be Leisure And Bringing It To The Hotel

  • amateurcreampieblowjobGIGLgigolo gigolomr mgigoloGIGL-652GIGL652gigl00652
    • 2021-07-09
    180 min

    IPX-696 Go To Masturbation! !! Why Don'T You Live Alone At Your Stay Home With Mutual Masturbation Rather Than Chewy! ?? "H Together" Airi Kijima

  • airi kijimacreampiesingle workIPXidea pocketinnabartissueIPX-696IPX696ipx00696
    • 2021-08-07
    125 min

    SABA-717 "Because I'M Going To Get Pregnant With An Old Man'S Baby After Quitting School ..."

  • amateurcreampiebig titsSABAs kyuu shiroutotodoSABA-717SABA717saba00717
    • 2021-09-23
    93 min

    OKS-120 Hanakari Mai Wet And Shiny, Perfect Fit God Swimsuit Enjoy The Cute Girls' School Swimsuits! Av That Starts With Changing Clothes Voyeur And Enjoys Fetish Close-Ups Such As Shaved Hair, Hami Hair, Joriwaki, Lotion Soap Play, Swimsuit Bukkake,

  • flower huntingschoolgirlbeautiful girlOKSoyaji no kosatsukami sukumizuOKS-120OKS1201oks00120
    • 2021-10-08
    105 min

    GZAP-054 A Gal With A Strong Sense Of Justice Who Caught An Underwear Thief Infesting The School Is A Big Cock Outrageous 3P Chasing After A Devil Vaginal Cum Shot To A Criminal Who Has Been Reversed ... Crying

  • saotome rabu shimotsuki runaGZAPprestigezapGZAP-054GZAP054
    • 2021-10-16
    107 min

    MKON-064 Even Though I Liked It First ... Yuzu Shirakawa, A Child Of A Convenience Store Clerk Who Holds Her Hand Tightly When Handing Over, Has Become A Bitch Toilet That Wants To Have Sex With Anyone

  • yuzu shirakawacreampieuniformMKONkaguya hime pt mousozokuyumesaki ichiroumikonMKON-064MKON064mkon00064
    • 2021-10-21
    72 min

    REBD-595 Miharu4 Everlasting Paradise, Miharu Usa

  • miharu hanasakisingle workREBDrebeccatakahashi takuyaREBD-595REBD595h-346rebd00595



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free