SYK-008 [Sex Desire/Appetite/Sleep Desire] 8 Nice Buddy My Beloved Yuina Chuwan 173Cm Panty G70 From 59 Crunch 59 ~ Shiri 102 [Big Ass Amateur] Taki Yuina




VENUMEYDSSNIWANZNACXBBANPPPDAPODABWCESDSPRDSANMARASHKDFSDSSCAWDDASDSDABCJODMIAA
            147 min
Skip Ad

SYK-008 [Sex Desire/Appetite/Sleep Desire] 8 Nice Buddy My Beloved Yuina Chuwan 173Cm Panty G70 From 59 Crunch 59 ~ Shiri 102 [Big Ass Amateur] Taki Yuina

Views
49
Release date :
2023-07-02
Length :
147 min
Models:
taki yuina
Categories :
amateurhigh visionjavcensoredtoybig buttsingle workjavm womancreampiecensored
Label :
SYK 008 SYK008 SYK h_113syk00008
Description:
SYK-008 [Sex Desire/Appetite/Sleep Desire] 8 Nice Buddy My Beloved Yuina Chuwan 173Cm Panty G70 From 59 Crunch 59 ~ Shiri 102 [Big Ass Amateur] Taki Yuina Release date 2023-07-02 Length 147 min h_113syk00008 ,taki yuina,amateur, single work, m woman, toy, high vision, censored, jav, javcensored, big butt, creampie SYK-008 SYK008 SYK




2022-12-06
95 min

MOGI-066 I Couldn'T Suppress The Pain Of My Pussy, So I Paid To Take A Replacement Photo! 173Cm Tall Pussy Nilingus Lover Favorite Older Sister Taki Yuina 25 Years Old, Juice Overflows From Holes All Over Her Body, Sweaty, Big Climax All Day Long

  • taki yuinaamateursingle workMOGIsod createremi remi new worldmogitateMOGI-066MOGI066
    • 2023-02-14
    127 min

    MOGI-077 As Soon As You Open The Front Door, You Have Sex! An Amateur Echiechi Sister Is Impatient And Squeezing Her Tendry-Fucking Masochistic Dicks Till Morning! Taki Yuina

  • taki yuinacreampiebig titsMOGIsod createremi remi new worldMOGI-077MOGI077
    • 2023-03-03
    95 min

    VEC-576 My Wife'S Best Friend Yuina Taki Came To Preach About Her Unbelievable Horny Husband Who Was Caught Cheating

  • taki yuinacreampiemature womanVECvenuskaniemegami venusVEC-576VEC576
    • 2023-04-07
    140 min

    JUQ-260 “Instead Of Making Me Delinquent On Rent, I'Ll Put The Semen I'Ve Stored Up For 1 Month Into My Wife'S Womb!!” Tsumadaki Yuina Fell Into A Super Guess House That Makes Bugs Spit Bugs Run Just By Looking At Her Face

  • taki yuinacreampiemature womanJUQJUQ-260JUQ260
    • 2023-04-14
    150 min

    JUFE-462 Unknowingly Tempted By Her Big See-Through Panty Ass! Yuina Taki, A Natural Wife Who Makes Men In The Neighborhood Get A Teen Erection And Gets Creampied Over And Over Again With A Big Cock Demon Piston

  • taki yuinacreampiesingle workJUFEJUFE-462JUFE462
    • 2023-04-28
    122 min

    HODV-21759 My Girlfriend'S Older Sister, Who Doesn'T Have A Lot Of Sexual Desire, Runs Wild With Her Plump Big Butt! I Was Slutty By Piling Up Pile All The Time, And It Went On Me! Taki Yuina

  • taki yuinacreampieslutHODVHODV-21759HODV21759
    • 2023-05-13
    106 min

    DPMI-081 Body Conscious Yuina Taki

  • taki yuinasingle workDPMIDPMI-081DPMI081
    • 2023-05-12
    120 min

    MVSD-545 My Frustrated Wife'S Stuffy, Plump, And Big Butt Was Irresistible And Ran Wild! That'S Right Away! Sweaty Press! Buttocks Are Freaking Out! Ass Hole Hikuhiku! Shonben Dada Is Leaking Out Of My Face, My Face Is Amazing! Taki Yuina

  • taki yuinacreampiesquirtingMVSDMVSD-545MVSD545
    • 2023-06-03
    140 min

    PKPD-243 A Simple Job Where You Just Get Creampied 173 Cm Tall G Cup Glamour Ol Yuina 23 Years Old Taki Yuina

  • taki yuinacreampiebig titsPKPDPKPD-243PKPD243
    • 2023-06-05
    126 min

    NACR-672 Yuina Taki Visits Your House! Attractive Big Ass Fan Service

  • taki yuinacreampieblowjobNACRNACR-672NACR672
    • 2023-06-16
    210 min

    MUKD-485 Everyone In The 170 Cm Tall Women'S Volleyball Club Is Unexpectedly Horny. Club Girls Who Smell Sweat Smell Smell Are Carnivorous Slutty Girls Harem Reverse 4P Kinoshita Himari Iruma Akanetaki Yuina

  • himari kinoshita himari hanazawa iruma akaneschoolgirlslutMUKDMUKD-485MUKD485
    • 2023-07-02
    147 min

    SYK-008 [Sex Desire/Appetite/Sleep Desire] 8 Nice Buddy My Beloved Yuina Chuwan 173Cm Panty G70 From 59 Crunch 59 ~ Shiri 102 [Big Ass Amateur] Taki Yuina

  • taki yuinacreampieamateurSYKSYK-008SYK008
    • 2023-07-08
    128 min

    AVSA-253 Super Fisheye Fetishism Impressive Excitement Honey Shoot Tall Body Plump Fleshy Erotic Body Yuina Taki

  • taki yuinaslutsingle workAVSAAVSA-253AVSA253
    • 2023-07-20
    122 min

    NACR-689 Tall Beautiful Women Want To Be Blamed Until They Faint! An Unscripted Knock-Out Performance With Yuina Taki!!

  • taki yuinacreampiesingle workNACRNACR-689NACR689
    • 2023-09-16
    117 min

    BONU-031 I Found My Girlfriend On A Doujin Av Site And Posted A Video Where She Gets Creampied With Her Nipples, Yuna Taki

  • taki yuinacreampieslutBONUBONU-031BONU031
    • 2023-09-23
    130 min

    ALDN-213 After The Reunion... Taki Yuna

  • taki yuinacreampiemature womanALDNALDN-213ALDN213
    • 2023-09-29
    154 min

    DVEH-015 Taki Yuna, A Tall, Beautiful Personal Trainer With A Voluptuous, Big Butt, And Repeated Insatiable Collapse And Temptations In Search Of The Finest Protein (Sperm)

  • taki yuinacreampiesingle workDVEHDVEH-015DVEH015
    • 2023-11-21
    157 min

    SDDE-708 “Always Fuck” Bikini Massage 11: Plump Close Contact Healing Edition By 4 Big Butt Therapists With Hips Over 90Cm

  • maeda minami ai tenharucreampiebig titsSDDESDDE-708SDDE708
    • 2023-12-16
    151 min

    MMKZ-139 Big Butt Is So Amazing! ~ Limited To Hips 100 Cm Or More! ~ Taki Yuina

  • taki yuinasingle workMMKZMMKZ-139MMKZ139



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free