GVG-678 Ayase Momono Suddenly With A Miracle Newcomer Av Debut

HZGDONEZMIDESQTEAUKGAVSADASDDTTPPPDWAAADASDMIDVKSBJSDABAUKGSPRDPREDRBDVENUHND
            135 min
Skip Ad

GVG-678 Ayase Momono Suddenly With A Miracle Newcomer Av Debut

Views
1.502M
Release date :
2018-05-02
Length :
135 min
Models:
ayase momono
Categories :
small milkjavdebut workjavcensoredhigh visionsingle workcensoredanal sex
Director :
updating
Studio :
glory quest
Label :
glory quest GVG 678 GVG678 GVG 13gvg00678
Description:
GVG-678 Ayase Momono Suddenly With A Miracle Newcomer Av Debut Release date 2018-05-02 Length 135 min 13gvg00678 Director updating Label glory quest Studio glory quest ,ayase momono,jav, small milk, high vision, debut work, censored, javcensored, single work, anal sex GVG-678 GVG678 GVG




2018-05-02
135 min

GVG-678 Ayase Momono Suddenly With A Miracle Newcomer Av Debut

  • ayase momonosingle workGVGglory questupdatingGVG-678GVG678
    • 2018-07-15
    113 min

    BIJN-134 Look At My Tremendous Sex ... Orgy, Skewering, Creampie, Serious Sex That Goes Crazy With Endless Pleasures! Ayase Momono

  • ayase momonocreampiesingle workBIJNbijin majoupdatingBIJN-134BIJN134
    • 2022-05-20
    240 min

    OPBD-199 Best Rezusuka Masterpiece Selection Vol.2 6 Movies 4 Hours

  • kimura tsuna asagiri hikarilesbianOPBDoperaOPBD-199OPBD199
    • 2021-06-15
    81 min

    PPMNB-108 It'S Not Just Cute! / Natsuki

  • amateurbig titsbeautiful girlPPMNBcranePPMNB-108PPMNB108h-706ppmnb00108
    • 2021-06-04
    120 min

    SSIS-078 Miharu Usa For 3 Days With Her Best Friend Av Actress And All-You-Can-Eat While My Girlfriend Is Absent

  • miharu hanasakibig titsblowjobSSISs1 no 1 stylekc takedaSSIS-078SSIS078ssis00078
    • 2021-06-25
    106 min

    YSN-553 The Event That My Overprotected Daughter Recently Learned ● It Was So Amazing That I Could Hear My Erotic Itinerary And Embarrassing M Propensity When I Went To The Experimental Table Even Though I Thought That It Would Not Be Possible To Tak

  • mao watanabe reallyblowjobYSNnonYSN-553YSN553h-127ysn00553
    • 2021-07-09
    180 min

    MIFD-168 Two Experienced People. Experience Twice. No One Has Dyed It Yet. Ub Pure 19-Year-Old Debut

  • yoshimi honobig titsbeautiful girlMIFDmoodyzhirokoji osakimoodyz freshMIFD-168MIFD168mifd00168
    • 2021-07-30
    185 min

    ABW-120 Customs Tower Sexual Feeling Full Course 3 Hours Special Act. 37 Erotic Deviation Value Max Slender Beautiful Girl Fulfills All Your Desires 185 Minutes! !!

  • yuiki ruminasoloworkABWprestigecharlie nakataabsolutely wonderfulABW-120ABW120
    • 2021-08-20
    240 min

    REXD-377 A Trap Charged In Protein! Let'S Finish The Female Body Modification Plan With This!

  • amateurcreampieREXDreddogroupREXD-377REXD377rexd00377
    • 2021-08-20
    150 min

    MISM-211 Anal Throat Back Vaginal Hole Greedy 3 Hole Masochist Fucker Ayaka Mochizuki

  • ayaka mochizukibig titsdeepthroatMISMemumusume labinnabarMISM-211MISM211mism00211
    • 2021-08-26
    130 min

    TMY-002 Kimo Man Otaku Revenge Video Tawawaruru

  • amateurcreampiebig titsTMYtamaya labeltamaya sankuchuariTMY-002TMY002h-580tmy00002
    • 2021-09-10
    120 min

    NGOD-155 Wife 2 Haruna Hana Who Was Fucked At The Toilet At The Station By A Middle-Aged Man Who Is A Part-Timer

  • haruna hanamature womansingle workNGODjet eizomanji groupNGOD-155NGOD155ngod00155
    • 2021-09-24
    120 min

    HMN-040 Rookie Is Already 20 Years Old ... I Want To Throw Away My Virginity! !! Although The Number Of Experienced People Is 0, She Has Too Much Knowledge Of Sex And Makes A Vaginal Cum Shot Av Debut Kotori Chino

  • kotori chinocreampiebig titsHMNhonnakaarashiyama michiruHMN-040HMN040hmn00040
    • 2021-10-01
    150 min

    CAWD-293 "Because I Regret Having Made You Abstinent!" Ignore The Script And Rules Completely! All-You-Can-Eat Spear All-You-Can-Eat White Peach Hana X Ito Meru Estrus Female Plan

  • ito meru white peachcreampieslutCAWDkawaiiCAWD-293CAWD293cawd00293
    • 2021-10-21
    120 min

    FSDSS-299 My Girlfriend Minori Kawana Who Was Forced To Force An Obscene Underwear Model And Was In Heat While Being Ashamed

  • real village henancreampielingerieFSDSSfalenoeightfaleno starFSDSS-299FSDSS2991fsdss00299
    • 2021-10-30
    160 min

    DSS-227 Amateur Blow Pick-Up! !! Get! Miss ○ Yama Gakuin Contest Finalist God Beauty & Yurufuwa Women'S Famous Tikt ● K ● R Is Hit Immediately Paco! ~ Uncut Delivery Sp From Picking Up To Fucking! !!

  • amateuramateurblowjobDSSmomotarou eizou shuppandukelady huntersDSS-227DSS227dss00227
    • 2021-11-06
    129 min

    SNTX-001 Pick-Up Sex Hidden Camera-Av Released As It Is. Office Worker Vol.1

  • amateuramateurbeautiful girlSNTXsou mi sha mousou zokusoumisha mousou zokuSNTX-001SNTX001sntx00001



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free