kiss kiss




SQTEAUKSMIDVNATRMARAJUFECAWDDTTSSISMIDEWAAAMILKDASDPPPDNACRRBDHZGDAMBIIPXGMEM

2023-03-10
240 min

BBSS-070 Best Lesbian Slutty Girl Heaven With Twisted Nipples & Dripping Off Kinky Juice With A Jubo Jubo Clerk!!

  • aoi kururugi nene sakuralesbianslutBBSSbibianBBSS-070BBSS070bbss00070
    • 2023-03-10
    139 min

    IPZZ-028 ≪Complete Virtual≫ Asmr That Envelops All Five Senses, Shikoshiko, Amazing Tech, Onasapo, Airi Kijima

  • airi kijimacreampieblowjobIPZZidea pocketzampatissueIPZZ-028IPZZ028ipzz00028
    • 2023-03-10
    155 min

    JUQ-219 Shocking Revival The Revival Of Impact Shiina Yuna Shines Turbulent For The First Time In 10 Years, Seriously Sweaty Sex 3

  • yuna shiinabig titsmature womanJUQmadonnamamezawa mametaroubd madonnaJUQ-219JUQ219juq00219
    • 2023-03-10
    120 min

    IPZZ-004 My Sister-In-Law'S Lips Are So Comfortable... Continuous Dense Velociss Sex Kami Anna

  • anna kamislutsingle workIPZZidea pocketdoragon nishikawatissueIPZZ-004IPZZ004ipzz00004
    • 2023-03-10
    150 min

    BBAN-412 Underwear Model Lesbian ~Sexual Harassment Monitor Job Where A Whitened College Girl With Big Breasts Is Dyed With Shame And Develop Soggy Sensuality~ Rio Rukawa Hachino Tsubasa

  • nagarekawa rio yano tsubasabig titslesbianBBANbibianmishima rokusaburoBBAN-412BBAN412bban00412
    • 2023-03-10
    117 min

    SSIS-634 Butchigiri'S Good Looks And Ito Seika Prove Her Lewd Face For The First Time In Her Life! First Experience 3 Production Special

  • ito seikasquirtingsingle workSSISs1 no 1 styletake dSSIS-634SSIS634ssis00634
    • 2023-03-10
    120 min

    BBAN-407 An Innocent Beautiful Girl From The Countryside Who Has Too Much Time Explodes And Is Immersed In Sweaty Lesbian Intercourse Kotone Hina Tachibana

  • kotoneka hinano tachibanaschoolgirllesbianBBANbibianwantoppuBBAN-407BBAN407bban00407
    • 2023-03-10
    150 min

    BBAN-417 The Secret Of A Big Breasts Wife Crazy With Desire... Drowning In Big Breasts Close Contact Lesbians Seiri And Ah Yoshine Yuria

  • seiri yoshine yuriabig titslesbianBBANbibiankubo nawoyukiBBAN-417BBAN417bban00417
    • 2023-03-10
    120 min

    BBAN-406 The Person Who Filled My Painful Body And Loneliness With A Lesbian Housing Complex Was A Woman In The Same Situation Who Was Younger But Had Tolerance And A Big Bust. Komatsu Anmien Waka

  • anzu komatsu misono wakabig titslesbianBBANbibiantake dBBAN-406BBAN406bban00406
    • 2023-03-10
    160 min

    ACZD-076 Anal Masochist Teacher Training Record 3 [Nishiyama Mayuko (Pseudonym), Elementary School Teacher]

  • nishiyama mayukoanalblowjobACZDsanwa shuppanmania club henshuubuabnormal.companiesACZD-076ACZD076h-019aczd00076
    • 2023-03-10
    160 min

    JUQ-209 The Summer Is Sweltering Heat. A Foreign Wife Falls Into Kiss Intercourse Involving Sweat And Saliva By Her Disgusting Father-In-Law... Lauren Hanakoi

  • lauren karenmature womansingle workJUQmadonnakimura hiroyukiJUQ-209JUQ209juq00209
    • 2023-03-10
    132 min

    ACZD-091 Two Days Of Personal Photography That Really Made Masochistic Pretty Boy Chibitori Go Crazy

  • chibitorianalblowjobACZDsanwa shuppane d mickeyabnormal.companiesACZD-091ACZD091h-019aczd00091
    • 2023-03-10
    120 min

    IPZZ-017 When I Took The Cute And Erotic Junior Office Lady Back To The Hotel... She Went Back And Forth With An “Unmistakable Woman” Who Went Beyond Measure. Nishinomiya Yume

  • yume nishinomiyacreampieblowjobIPZZidea pocketmontissueIPZZ-017IPZZ017ipzz00017
    • 2023-03-10
    180 min

    SSIS-619 'Shinonome Mirei' Makes An Emergency Attack On Masochist Man Kun'S House! Gcup Little Devil Pretty Girl Ejaculate 7 Ejaculation Documents A Day Who Turns Slutty When Ad Lib Is Full Open

  • shinonome mireislutsingle workSSISs1 no 1 stylemasaki naoSSIS-619SSIS619ssis00619
    • 2023-03-10
    142 min

    SSIS-633 Intersecting Bodily Fluids, Dense Sex Completely Uncut Special Arisu Shinomiya

  • shinomiya arisubeautiful girlsingle workSSISs1 no 1 stylemonSSIS-633SSIS633ssis00633
    • 2023-03-10
    150 min

    BBAN-411 Missed The Last Train With A Cheeky Junior And Shared Room Lesbian Kiyo Ami Natural Mizuki

  • kiyo ami tennen mizuki tennen kanonbig titslesbianBBANbibianmishima rokusaburoBBAN-411BBAN411bban00411
    • 2023-03-10
    240 min

    BBSS-071 Lolilez 4 Hours Of Intense Lesbian Sex Where Innocent Girls Are Frantically Seeking Each Other And Reaching Its Climax

  • miki aise abe mikakolesbianbeautiful girlBBSSbibianBBSS-071BBSS071bbss00071
    • 2023-03-09
    177 min

    NHDTB-753 An Aphrodisiac Girl Who Can'T Forget The Pleasure Of Being Spoiled By Her Boyfriend'S Sister While On A Kotatsu And Begs For An Aphrodisiac

  • amateurbig titsschoolgirlNHDTBnatural highrafutin maeshiroNHDTB-753NHDTB7531nhdtb00753
    • 2023-02-23
    157 min

    AKDL-219 Saseko, Who Is So Friendly And So Cute, Kisses And Has Sex With A Horny Girl Full Of Sexual Desire That Will Make You Fall In Love With Any Kind Of Cock Kokona Yuki

  • kokona yukisingle workAKDLakinoriakinoriAKDL-219AKDL2191akdl00219
    • 2023-02-23
    136 min

    AKDL-220 After School, Mashiro Minori Had Sex With Her Classmate In Big Ass And Black Pantyhose

  • mashiro minorischoolgirlsingle workAKDLakinoriakinoriAKDL-220AKDL2201akdl00220
    • 2023-02-16
    65 min

    GRMO-114 Unstoppable Continuous Orgasms Narumiya Hitoshi Devouring Unstoppable Pleasure No Matter How Many Times You Squeeze

  • hamazaki mao narumiya hitoshislutsingle workGRMOkageki chark shell abaloneGRMO-114GRMO114h-1535grmo00114
    • 2022-12-08
    124 min

    FSDSS-517 I Completely Controlled The Tamanokoshi Office Lady Who Turned Me Into Moss And Made A Mess With Ji Po At The Bottom. Yoshitaka Nene

  • nine yoshitakasingle workFSDSSfalenodazai chinpofaleno starFSDSS-517FSDSS5171fsdss00517
    • 2023-03-23
    154 min

    DANDY-847 When I Was Touching My Chick While Cleaning And Felt Flustered, The Nurse Unexpectedly Opened Her Eyes As A Slutty Girl And Crunched My Nipples! Lelo Rello!! Chupapapapapappa!! Vol.2

  • amateurblowjobbeautiful girlDANDYdandyemerald fujisakiDANDY-847DANDY8471dandy00847
    • 2023-03-04
    120 min

    EVIS-457 Saliva-Covered Face-Licking Lesbian

  • suzuya strawberry full moon hikarilesbianslutEVISebisusan mousou zokubyakkoEVIS-457EVIS457evis00457
    • 2023-03-04
    121 min

    TLZ-015 Excuse Me, Won'T You Be Lesbian With Me?

  • rie takeuchi naoki yuukilesbianmature womanTLZrubytakuma chinkuroyuriTLZ-015TLZ015tlz00015
    • 2023-03-04
    134 min

    YMDD-313 Big Breasts Wife At 3 P.M. - The Smell Of Secret Lust That A Chaste Busty Wife Gets Wet - Hime Hikari

  • hikari himebig titsblowjobYMDDmomotarou eizou shuppanasoumakoto tsugijaku momoYMDD-313YMDD313ymdd00313
    • 2023-03-04
    120 min

    EVIS-458 Outdoor Exposure Lesbian

  • megumi shino nagaokalesbianslutEVISebisusan mousou zokuEVIS-458EVIS458evis00458
    • 2023-03-04
    138 min

    BAB-085 Kiss Speciality Championship 5 Guess Fans Exchange Saliva Thanksgiving Rukawa Rio

  • nagarekawa riobig titssingle workBABbabylon mousozokuBAB-085BAB085bab00085
    • 2023-03-04
    84 min

    HOKS-135 Lesbian Close Contact Cat And Tachi Middle-Aged Wife Midday Shellfish Match Mihara Sumire Narusawa Hinami

  • mihara sumire hinami narusawabig titslesbianHOKSfa pro platinumogurokku kinzoufa proHOKS-135HOKS135hoks00135
    • 2023-03-03
    200 min

    CAWD-500 Masochist Maiyuki Renting Ito Maisuki To Masochi-Kun'S House For 2 Nights 3 Days 3 Days Playing With Each Other Like An Idle Pet, Being Impatient And Disciplined Full Open Document

  • maiyuki itocreampieslutCAWDkawaiitake dCAWD-500CAWD500cawd00500
    • 2023-03-03
    120 min

    ATID-549 My Neighbor, Who Has Loud Sex Every Night, Seduces Me With Frustration While My Husband Is Away. I Was Sweaty And Screwed All Week Long. Tenkawa Sora

  • tenkawa sorasingle workATIDattackerskimura hiroyukiin madATID-549ATID549atid00549
    • 2023-03-03
    136 min

    PED-029 When The Two Of Them Were Alone For Only 7 Hours... As A Result, They Had 11 Shots Of Sex. Suzuki Mayu

  • suzuki mayuslutsingle workPEDdream ticketichinose kurumiPED-029PED02924ped00029
    • 2023-03-03
    181 min

    SKWD-006 Fuck With Amatoirs (Skwd-006)

  • amateurbig titsamateurSKWDdream ticketSKWD-006SKWD00624skwd00006
    • 2023-03-03
    122 min

    DFDM-032 “You Want My Drooling, Don'T You?” Hoshikawa Mai Is Doted On With Her Salivary Kiss Sealed Sex

  • hoshikawa maibig titsslutDFDMwaap entertainmenteightfearlessDFDM-032DFDM0322dfdm00032
    • 2023-03-02
    118 min

    AARM-164 Concentrated Velochu X Tornado Oil Hand Scrub X 2 Consecutive Fires!

  • kirishima walnut kohinata maisluthandjobAARMaroma kikakukadowaki shigeoaromaAARM-164AARM164aarm00164
    • 2023-03-01
    122 min

    VIO-36 J Series Lesbian Dense Body Fluids Mix

  • amateurlesbianVIOlahaina tokaivioletVIO-36VIO3636vio36
    • 2023-02-28
    119 min

    NUBI-072 Business Trip Men'S Beauty Salon Hidden Camera Hidden Camera Without Telling The Store Manager, Actual Service Without Live Fellatio

  • amateurbig titsNUBIkarimantannubiaNUBI-072NUBI072h-1112nubi00072
    • 2023-02-25
    301 min

    LZBS-092 Body Fluids Interacting With Gucciogucho During Dense Lesbian Sex With Velocis... Sweat, Tide, And Saliva 100 In A Row! 5 Carefully Selected Best Hours

  • ichika matsumoto mizuki yayoibig titssquirtingLZBSlez rerezure bestLZBS-092LZBS092lzbs00092
    • 2023-02-25
    126 min

    BDA-171 Full Course Complete Domination Full Position Vaginal Cum Shot Sex Kana Morisawa

  • kana morisawa kanako iiokacreampiesingle workBDAbermuda mousouzokuabashiri ichikanBDA-171BDA171bda00171
    • 2023-02-25
    168 min

    CEMD-301 Hatano Psychiatric Internal Medicine Brainwashing Lesbian Therapy Will Solve Your Problems.

  • yui hatano yuna mitsukilesbianmature womanCEMDserebu no tomoCEMD-301CEMD301cemd00301
    • 2023-02-25
    84 min

    HOKS-132 Close Lesbian Cat And Tachi, The Mud Of Lust, 365 Days Between Me And My Teacher, Maki Kyoko, Suzaki Miu

  • maki kyoko miu susakibig titslesbianHOKSfa pro platinumogurokku kinzoufa proHOKS-132HOKS132hoks00132
    • 2023-02-24
    120 min

    SSIS-616 The Difference In Age Between A Baby-Faced Caregiver Who Made It Difficult To Return Home Due To A Direct Typhoon And An Elder Who Was Scammed Many Times And Fell Into Pleasure Kano Yura

  • yura kannoblowjobbeautiful girlSSISs1 no 1 stylemaeda bungouSSIS-616SSIS616ssis00616
    • 2023-02-23
    181 min

    SUN-077 Flirtatious Blonde And Dark-Haired Flirtatious Date With Squirting Lesbians And Showing Off Their Fingers With Pleasure

  • amateursquirtinglesbianSUNsunaoi renaSUN-077SUN0771sun00077
    • 2023-02-23
    121 min

    FSDSS-548 Saliva Jurujuru Adult Kiss... Thick Velochu Tutor'S Dense Velocus Lesson Ono Yuko

  • yuko onoblowjobhandjobFSDSSfalenodazai chinpofaleno starFSDSS-548FSDSS5481fsdss00548
    • 2023-02-11
    182 min

    DGCEMD-292 ★ Limited Streaming! Bonus Footage Included ★ First Lesbian Ban Lifted! Kamisaka Tomoko With Shinmura Akari

  • tomoko kamisaka akari shinmurabig titslesbianDGCEMDcelebrity friendDGCEMD-292DGCEMD292dgcemd00292
    • 2023-02-09
    154 min

    AKDL-218 [Woman Getting Fucked At Work] The Rookie Nurse Who Is Enthusiastic About Her Work Is Actually My Friends Nurse Machi 23 Years Old Ikuta Machi Who Licks Me With A Terrible Jubbo Fellas While I'M At Work

  • ikuta townsingle worknurseAKDLakinoriakinoriAKDL-218AKDL2181akdl00218
    • 2023-02-09
    152 min

    AKDL-217 A Humiliating Part-Time Job For Knee-Highs! Is It A Housework Agency College Student In The Absolute Domain Or Is It 20-Year-Old Yukari'S

  • is it yukari ssingle workdramaAKDLakinoriakinoriAKDL-217AKDL2171akdl00217
    • 2023-01-26
    117 min

    FSDSS-534 A Record Of A Sober, Big-Breasted Female College Student 'Growing' To An Unmistakably Busty Older Sister With A Sexual Desire That Surpassed Her Virgin Boyfriend. Hongo Ai

  • ai hongo nikaido yumeblowjobhandjobFSDSSfalenodazai chinpofaleno starFSDSS-534FSDSS5341fsdss00534



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free