4k




BLKDASDHODVNATRNGODROYDHNDDTTHDKAAUKGWAAAMEYDADNCHRVSANAVSAHMNGMEMDASDKSBJ

2023-03-04
128 min

BIJN-239 The Documentation Excise Sex Breathing Instance Breathing Instincts - A Beautiful Wife Who Wants To Urinal - Breaking Limits - Breaking The Limits Of Incontinence Orgy Hazuki Wakamiya

  • wakamiyabig titssingle workBIJNbijin majoBIJN-239BIJN239bijn00239
    • 2023-03-03
    118 min

    CAWD-505 I Gave In To The Temptation Of A Slukawa Little Devil At My Part-Time Job, And I Drowned In Secret Meetings, Guess Adulterous, Creampied Sex... Miki Ruru

  • mishiro rurucreampieuniformCAWDkawaiinikusonCAWD-505CAWD505cawd00505
    • 2023-03-03
    136 min

    HZGD-241 An Aphrodisiac Was Served By A Younger Man She Met On An App... Yuri Oshikawa, A Wife With Colossal Breasts Who Drowned Into Kinky Pleasure And Goes Crazy

  • yuri sugawacreampiebig titsHZGDhitodzuma hanazono gekijouzampaHZGD-241HZGD241h-1100hzgd00241
    • 2023-03-03
    299 min

    WZEN-065 Banned Best Rexpro Red Line_01

  • amateurcreampiedeepthroatWZENwaap entertainmentnaomiWZEN-065WZEN0652wzen00065
    • 2023-03-03
    238 min

    MIDV-263 The Female Face Is Fully Open! Premature Ejaculation Squeaky Limit Break!! 4Sex Wobab

  • gubasquirtingbeautiful girlMIDVmoodyzkyouseimoodyz divaMIDV-263MIDV263midv00263
    • 2023-03-03
    119 min

    VDD-174 Secretary In... (Intimidation Suite) Shiokawa Sea Urchin

  • shiokawa sea urchinsquirtingdeepthroatVDDdream tickettakuanvivid dori muchikettoVDD-174VDD17424vdd00174
    • 2023-03-03
    123 min

    HZGD-240 Busty Empress Yuzu Developed Her Sensuality By Her Hated Pervert Father-In-Law And Was Trained By A Premature Ejaculation Pussy That Doesn'T Stop Even If She Squirts Right Away

  • emperor yuzucreampiesquirtingHZGDhitodzuma hanazono gekijouoosaki hirokoujiHZGD-240HZGD240h-1100hzgd00240
    • 2023-03-02
    244 min

    STSK-067 Guinea Pig Devil Health Checkup Cusco Extended Coma ● New Members Of Society Targeted By Pervert Doctors And Made To Sleep

  • amateurcreampieamateurSTSKshirouto 39STSK-067STSK067h-1605stsk00067
    • 2023-03-02
    128 min

    JRZE-136 First Shoot Of A Married Woman Documentary Miyamoto Noriko

  • miyamoto norikocreampiemature womanJRZEcenter villageminatoyashoku ureJRZE-136JRZE136h-086jrze00136
    • 2023-03-02
    150 min

    STSK-068 “Strong Obscene Outflow” “Black Club Activity” Female Imitation Group Sex/Ekiden Powerhouse Athletic University Athletics/4 Victims

  • amateurcreampieblowjobSTSKshirouto 39STSK-068STSK068h-1605stsk00068
    • 2023-03-02
    321 min

    STSK-066 Fall In Darkness Cosplay Photo Session Fainted ● Model Job Victims And J○4 People Who Dream Of Being Idols

  • amateurcreampieschoolgirlSTSKshirouto 39STSK-066STSK066h-1605stsk00066
    • 2023-03-02
    285 min

    STSK-065 Big Orgy 10P Joint Party Good Friends 5 Person Jd Biman Yang Cavitch After Pill 3Rd Pill

  • amateurcreampieamateurSTSKshirouto 39STSK-065STSK065h-1605stsk00065
    • 2023-03-01
    129 min

    GOJU-224 Monster Mature Woman With Unlimited Sexual Desire Fuyu Is 54 Years Old And Her Daily Lust Explodes With Nonstop 6P Sex!!

  • amateurbig titsamateurGOJUisojinGOJU-224GOJU224h-1165goju00224
    • 2023-03-01
    132 min

    GOJU-225 It Feels So Good When I Have Sex That Makes Me Cry... Crying Ueto'S Exquisitely Beautiful Married Woman Hirona Tatinami 40 Years Old Av Debut Document

  • tachinami hironaamateurblowjobGOJUisojinGOJU-225GOJU225h-1165goju00225
    • 2023-03-01
    159 min

    DROP-083 Amateur Girls Are Too Good At Fellating!! 10

  • amateuramateurblowjobDROPoffice k sdrop office ksDROP-083DROP08336drop00083
    • 2023-02-28
    210 min

    STARS-776 Kominato Yotsuba Climax Development'S Petite, Sensitive Body Is Trembling While Making Her Tiny, Sensitive Body Shudder, The Greatest Extreme Orgasm In Jibun History! Big Cock Climax [Amazing 4K Video!]

  • kominato yotsubasquirtingbeautiful girlSTARSsod createdainanasod starSTARS-776STARS7761stars00776
    • 2023-02-25
    131 min

    SABA-814 The Job Of A Sauna Lady In A Cock Washroom

  • amateuramateurhandjobSABAs kyuu shiroutoSABA-814SABA814saba00814
    • 2023-02-25
    112 min

    ALDN-129 Naked Stepmom Narasaki Mizuki

  • mizuki narasakicreampiemature womanALDNtakara eizoutsukumo kyuutaaleddinALDN-129ALDN129aldn00129
    • 2023-02-25
    110 min

    BTIS-126 Transvestite Beautiful Boy 70 Marisa

  • amateurBTISbishounen shuppanshanimura hitoshijosou bishounenBTIS-126BTIS126btis00126
    • 2023-02-25
    138 min

    ALDN-132 After The Reunion... Asami Mizuhata

  • mizubata asamicreampiesingle workALDNtakara eizoutakara hiroshialeddinALDN-132ALDN132aldn00132
    • 2023-02-25
    107 min

    ALDN-130 What Do You Do When An Old Lady Like Me Gets Excited... Takazono Yuriko

  • takazono yurikocreampiemature womanALDNtakara eizoutsukumo kyuutaaleddinALDN-130ALDN130aldn00130
    • 2023-02-25
    97 min

    ALDN-128 After All Single Mothers Are The Best... Akimoto Miori

  • akimoto mioricreampiemature womanALDNtakara eizoutsukumo kyuutaaleddinALDN-128ALDN128aldn00128
    • 2023-02-25
    112 min

    AGAV-084 Rookie Gravure Idol Honoka Airi Brainwashed And Trained By A Nipple Development Cult

  • hobana airisingle workAGAVsex agentaoi buttonAGAV-084AGAV084agav00084
    • 2023-02-25
    109 min

    NSFS-164 The 15 Rapped Wife Made By The Man Who Fucked - Forcibly Raped By Her Husband'S Sleeping Side... Satsuki Ena

  • ena satsukisingle workdramaNSFSnagae stylenagaeNSFS-164NSFS164nsfs00164
    • 2023-02-25
    117 min

    ALDN-131 My Mother-In-Law Seems Pregnant Too. Takarada Monami

  • takarada monamicreampiemature womanALDNtakara eizousumineko sanpeialeddinALDN-131ALDN131aldn00131
    • 2023-02-25
    164 min

    NSFS-163 In Front Of My Boss... My Wife Became A Nude Model. 5 Princess Hikari

  • hikari himebig titsmature womanNSFSnagae styletomitake taroNSFS-163NSFS163nsfs00163
    • 2023-02-25
    110 min

    AVSA-236 Sex Toy Covered With Semen Covered By Continuously Deep Throat Sex Doll Mio Ichijo

  • ichijo miocreampiedeepthroatAVSAavstei ja wareavscollectorsAVSA-236AVSA236avsa00236
    • 2023-02-25
    135 min

    GMEM-089 Insane Torture Research Institute Tall Queen Madness Remains Flame Climax ~ Tall Queen Strong ● Crazy Explosion Climax ● Crazy Explosion Climax ~ Aoi Yurika

  • yurikasingle workGMEMavsbaba za babiiavscollector s goldGMEM-089GMEM089gmem00089
    • 2023-02-25
    159 min

    ALDN-127 My Best Friend At That Time Was... My Friend'S Mother, Yoshii Miki

  • good miki ryoko izawa miki yoshiicreampiemature womanALDNtakara eizouohare konaleddinALDN-127ALDN127aldn00127
    • 2023-02-25
    106 min

    USBA-059 The Girl I Admire Is My Childhood Friend In Bishoujo Ring ● Masochist Girl Who Loves Cocks Kashiwagi Konatsu

  • kashiwagi konatsubdsmsingle workUSBAavsusubashi suiavscollectorsUSBA-059USBA059usba00059
    • 2023-02-25
    128 min

    AVSA-235 'Ingo' In God Ecstasy Blame Brainwashing Slutty Woman Who Derails Man'S Reason With Bombshell Erotic Voices And Obscene Obscene Words!! Kinky Slutty Girl Dirty Talk Haruna Hana

  • haruna hanabig titsslutAVSAavsbuddha davscollectorsAVSA-235AVSA235avsa00235
    • 2023-02-25
    297 min

    ROOM-050 Rental Female Student Secret Part-Time Job That No One Can Tell Me File2

  • sumire kuramoto hironaka minamicreampieschoolgirlROOMhomeroom homeroom mousozokuROOM-050ROOM050room00050
    • 2023-02-25
    124 min

    AGMX-143 Masochist Man Restrained! Strong ● Ejaculation Game

  • tsukasa nagano mei uesakablowjobslutAGMXsex agentAGMX-143AGMX143agmx00143
    • 2023-02-24
    180 min

    SSIS-595 The Best Men'S Esthetic Salon Kawakita Ayaka That Will Leave You Captivated

  • ayaka hebeihandjobsingle workSSISs1 no 1 styleoosaki hirokoujiSSIS-595SSIS595ssis00595
    • 2023-02-24
    119 min

    SSIS-613 Divine Milk Service Fuzoku Fuzoku Washio Mei Will Play Her Boobs Carefully With A Heavy, Beautiful Jcup

  • mei washiosingle workSSISs1 no 1 styletake dSSIS-613SSIS613ssis00613
    • 2023-02-24
    130 min

    T28-637 Incest Intense Sexual Intercourse With My Big Breasts Sister Who Went Back To The Countryside Kobana On

  • floretscreampiebig titsT28tmaT28-637T2863755t2800637
    • 2023-02-24
    163 min

    SSIS-601 Divine Breast Porori Bombardment Paiz Maniac Sex Shop Yumeno Aika Where Everyone Can Enjoy Obscene Costume Boobs Without Taking Them Off

  • yumeno aikabig titsblowjobSSISs1 no 1 styleoosaki hirokoujiSSIS-601SSIS601ssis00601
    • 2023-02-24
    121 min

    SSIS-625 Okuda Saki Is Depressed When She Sees Her Homeroom Teacher Okuda-Sensei, Who Saved Me From Being Bullied

  • saki okudabig titssingle workSSISs1 no 1 stylekitorune kawaguchiSSIS-625SSIS625ssis00625
    • 2023-02-24
    159 min

    T28-638 On The Day My Parents Weren'T Around, I Had Sex With My Little Sister All Day Long Until My Sperm Ran Out. Tsuburai Moeka

  • marui moekabeautiful girlsingle workT28tmaT28-638T2863855t2800638
    • 2023-02-24
    301 min

    REXD-460 My Deceased Husband'S Debts Now... I Can'T Believe There Is Such A Thing “Please Forgive Only My Daughter...”

  • amateurcreampieschoolgirlREXDreddogroupREXD-460REXD460rexd00460
    • 2023-02-24
    120 min

    IBW-908Z “I Came To See My Uncle...” My Uncle Who Lives In The Country Loves My Niece Yura

  • yura kanacreampiebeautiful girlIBWi b worksIBW-908zIBW908z504ibw00908z
    • 2023-02-24
    147 min

    SSIS-622 A Married Woman'S Secretary'S Secret (Secret) Is Made To Sign An Obedience Contract With Her Husband'S Boss And Is Being Perverted And Trained... Ichika Hoshimiya

  • ichika hoshimiyasingle workSSISs1 no 1 stylenikusonSSIS-622SSIS622ssis00622
    • 2023-02-18
    359 min

    DAMX-003 Business Trip Men'S Spa Voyeur Vol.02

  • amateuramateurDAMXdama chanDAMX-003DAMX003h-1647damx00003
    • 2023-02-11
    182 min

    DGCEMD-292 ★ Limited Streaming! Bonus Footage Included ★ First Lesbian Ban Lifted! Kamisaka Tomoko With Shinmura Akari

  • tomoko kamisaka akari shinmurabig titslesbianDGCEMDcelebrity friendDGCEMD-292DGCEMD292dgcemd00292
    • 2023-02-09
    154 min

    AKDL-218 [Woman Getting Fucked At Work] The Rookie Nurse Who Is Enthusiastic About Her Work Is Actually My Friends Nurse Machi 23 Years Old Ikuta Machi Who Licks Me With A Terrible Jubbo Fellas While I'M At Work

  • ikuta townsingle worknurseAKDLakinoriakinoriAKDL-218AKDL2181akdl00218
    • 2023-02-09
    152 min

    AKDL-217 A Humiliating Part-Time Job For Knee-Highs! Is It A Housework Agency College Student In The Absolute Domain Or Is It 20-Year-Old Yukari'S

  • is it yukari ssingle workdramaAKDLakinoriakinoriAKDL-217AKDL2171akdl00217
    • 2023-02-07
    68 min

    MDON-032 The Ban On “Real,” A Limited-Edition Madonna Actress, Has Been Lifted. Madooooon!!! Tada Arihana Pov

  • tada yukamature womansingle workMDONmadonnaMDON-032MDON032mdon00032
    • 2023-01-31
    116 min

    EUMD-002 Only Adulterous Sex Won! G-Cup Seduction Body Tutor Emily Seduces Her Student'S Father With Sexy Lingerie

  • emily hikari sakurabacreampiebig titsEUMDfave modesmmdEUMD-002EUMD002h-1718eumd00002



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free