there is




ABWSQTEMARASPRDADNHMNSANNACRSHKDAVSADASDHODVAUKGHNDAUKGJULPREDMIDEEBODDASD

2023-02-24
147 min

SSIS-622 A Married Woman'S Secretary'S Secret (Secret) Is Made To Sign An Obedience Contract With Her Husband'S Boss And Is Being Perverted And Trained... Ichika Hoshimiya

  • ichika hoshimiyasingle workSSISs1 no 1 stylenikusonSSIS-622SSIS622ssis00622
    • 2023-02-23
    70 min

    STCV-005 [Inexhaustible Sexual Desire] Kneading With A Blonde Gal J-type Who Masturbates 8 Times A Week! Boyfriend And Saffle Are Different Things, So When It Comes To SEX, There Is No Eye For SEX! [# J-kei Konekushon. # 3rd Person # 18 Years Old]

  • kurusu mikucreampiehandjobSTCVshirouto cloverSTCV-005STCV0051stcv005
    • 2023-02-23
    242 min

    AARM-162 This Is The Only Story, I Think The Panty Shots In Works That Specialize In Legs And Thighs Are Pretty Stupid Vol. 2

  • amateurslutAARMaroma kikakuaromaAARM-162AARM162aarm00162
    • 2023-02-18
    240 min

    ERDM-028 Will The Old Lady Of The Sales Lady Who Is Chased By Quotas Allow The Pillow Business If She Signs A Contract? 4 Hours

  • amateurmature womanERDMero daruma emanieljinanbouERDM-028ERDM028erdm00028
    • 2023-02-18
    240 min

    ERDM-026 An Erotic Oil Esthetic Salon That Pussy/Old Women Are Addicted To Is In Agony With Scattered Tides, Sweat, Drooling, And Slippery Massages For 4 Hours

  • amateurERDMero daruma emanieldebuto nzuERDM-026ERDM026erdm00026
    • 2023-02-17
    52 min

    KRS-183 Cute Mature Women Like Mature Women Who Are Cute Even When They Get Older 20

  • amateurcreampiebig titsKRSthis is it amateurKRS-183KRS183h-1631krs00183
    • 2023-02-17

    LBDD-018b Black Hair Beautiful Girl Is Junshin Karen / Yukari Noka (Blu-ray Disc)

  • yukari nonokasoloworkLBDDmedia artsLBDD-018bLBDD018bn-1515lbdd018b
    • 2023-02-17
    40 min

    KRS-184 I Didn'T Mean To Do That... 08

  • amateurcreampiesquirtingKRSthis is it amateurKRS-184KRS184h-1631krs00184
    • 2023-02-16
    190 min

    UMD-859 This Is A Serious Puke Face!! I Get This Kind Of Face When I Cum Sp5

  • ena satsuki shiori hiraihandjobUMDleotabu oosakiUMD-859UMD859125umd00859
    • 2023-02-15
    120 min

    ZOOO-058 A Relationship You Should Never Have... The Messy Sex That You Can'T Show To Your Husband Is Amazing!

  • sayako katagiri hitomi ohashicreampiebig titsZOOOzoooZOOO-058ZOOO058h-1515zooo00058
    • 2023-02-14
    121 min

    EUMD-003 I'M Going Crazy With 'Stop The Whole Time'! Revenge On Her 'Big Breasts And Sensual' Younger Boss Who Is Usually Bullish Sex J Cup Female Boss Minami Momo, Who Has A Voluptuous Body

  • minami peachcreampiebig titsEUMDfave modesmmdEUMD-003EUMD003h-1718eumd00003
    • 2023-02-14
    127 min

    MOGI-077 As Soon As You Open The Front Door, You Have Sex! An Amateur Echiechi Sister Is Impatient And Squeezing Her Tendry-Fucking Masochistic Dicks Till Morning! Taki Yuina

  • taki yuinacreampiebig titsMOGIsod createremi remi new worldMOGI-077MOGI0771mogi00077
    • 2023-02-13
    83 min

    NPH-005 Married Woman Aphrodisiac Oil Massage/ Her Shame Turns Into Pleasure And Her Body That Has Become Too Sensitive Is Incurable By Wanting A Cock, Mizuboku Maina

  • mai minamatasingle workNPHhibinoNPH-005NPH0051nph00005
    • 2023-02-13
    81 min

    NPH-004 Married Woman Aphrodisiac Oil Massage/ Her Shame Turns Into Pleasure And Her Body That Has Become Too Sensitive Is Incurable By Wanting A Cock Marazumi Hina

  • mihina azumihina mihina nagaisingle workNPHhibinonyanpero houseNPH-004NPH0041nph00004
    • 2023-02-10
    35 min

    KRS-181 A Married Woman Who Is In The Prime Of Cheating Is Creaming With Her Sensitive Body That Is In Season Now 20

  • amateurcreampiesquirtingKRSthis is it amateurKRS-181KRS181h-1631krs00181
    • 2023-02-10
    41 min

    KRS-182 Don'T You Want To See A Mature Woman Who Is A Late Bloomer? The Erotic Appearance Of A Sober Aunt 28

  • amateurcreampieamateurKRSthis is it amateurKRS-182KRS182h-1631krs00182
    • 2023-02-09
    154 min

    AKDL-218 [Woman Getting Fucked At Work] The Rookie Nurse Who Is Enthusiastic About Her Work Is Actually My Friends Nurse Machi 23 Years Old Ikuta Machi Who Licks Me With A Terrible Jubbo Fellas While I'M At Work

  • ikuta townsingle worknurseAKDLakinoriakinoriAKDL-218AKDL2181akdl00218
    • 2023-02-09
    152 min

    AKDL-217 A Humiliating Part-Time Job For Knee-Highs! Is It A Housework Agency College Student In The Absolute Domain Or Is It 20-Year-Old Yukari'S

  • is it yukari ssingle workdramaAKDLakinoriakinoriAKDL-217AKDL2171akdl00217
    • 2023-02-06
    82 min

    ERGV-048 Ki-Nedance'S Pov Shot With Her Former Boyfriend When She Was An Active Cheerleader Student Has Been Leaked. A Beautiful Woman With The Same Triplets Of Face, Big Breasts, And Slender Has A Strong Sexual Desire And Is Too Dangerous To Be Seen

  • amateurcreampiebig titsERGVhamedori.network second editionERGV-048ERGV048h-1472ergv00048
    • 2023-02-01
    100 min

    BUBB-126 What'S Inside Of A Staircase Schoolgirl'S Uniform Skirt Is Erotic Underwear Is Preferred

  • amateuruniformschoolgirlBUBBbukatsudoufujieta ryuuzouBUBB-126BUBB126436bubb00126
    • 2023-02-01
    300 min

    SCNN-003 001#Nyuru! Nururun! That'S So Creepy! Sucking All My Dicks Is So Hard! Blow Job Feber! 10 Perfectly Selected Amateur Girls! /Amateur Clover Chimpero Special Best!

  • amateuramateurblowjobSCNNamateur cloveramateur clover.complete bestSCNN-003SCNN0031scnn00003
    • 2022-11-10
    122 min

    FSDSS-503 While My Wife Is Away, There'S Nothing Wrong With The Countryside In The Summer, So I Spent A Lifetime Spear With My Cheeky Busty Stepchild Momojiri Kaname

  • kaname momojiribig titsschoolgirlFSDSSfalenoebifaleno starFSDSS-503FSDSS5031fsdss00503
    • 2022-11-10
    124 min

    FSDSS-508 Watanuki Koyomi Is Forced To Ejaculate Unlimited Fucking With Her Neighbor'S Round G Cup Boobs

  • watanuki koyomibig titsslutFSDSSfalenou kichifaleno starFSDSS-508FSDSS5081fsdss00508
    • 2022-11-10
    122 min

    FSDSS-507 Ichika Sensei Is A Genius Who Loves Nipples! Keep Kneading Your Nipples Even During Ejaculation, And The Amount Of Ejaculate Increases By 200%! (Compared To Our Company) Ichika Sensei

  • ichika senseiblowjobcosplayFSDSSfaleno2 rentai ritsu 25faleno starFSDSS-507FSDSS5071fsdss00507
    • 2022-07-09
    240 min

    SABA-781 Sexual Intercourse With A Runaway Girl Who Is Too Radical. 02 8 People 240 Minutes

  • amateurcreampiebeautiful girlSABAs kyuu shiroutotodoSABA-781SABA781saba00781
    • 2021-07-24
    240 min

    HUSR-240 The World'S No. 1 Beauty Rate! The Final Weapons Set Sp Of Russia, A Beautiful Powerhouse! What Is Such A High-Level Country ... Russia! !!

  • isabel clark ibanacreampiebig titsHUSRbigmorkalbukka thassuruHUSR-240HUSR24057husr00240
    • 2020-11-13
    112 min

    GNAB-040 If You Keep Kissing With A Sexual Cabaret That Is Erotic Than Naked And No Bra Raw Touch Ok, Miss Kyaba Has Become Serious ...

  • amateurslutGNABprestigebang prestigeGNAB-040GNAB040118gnab00040
    • 2019-10-01
    239 min

    SNIS-00484bod Oma ● This Is Kupaa. Kirara Asuka (Blu-ray Disc) (BOD)

  • asuka kirarabig titssoloworkSNISs1 no 1 stylemonSNIS-00484bodSNIS00484bodsnis00484bod
    • 2019-07-26
    154 min

    ABP-882 Super! See-Through Lewd School Class 03 See-Through Fetish Tokuno Sex That Beautiful Nude Is Transparent! Fumiho Fujie

  • fumiho fujieblowjobcosplayABPprestigec takeruabsolutely perfectABP-882ABP882118abp00882
    • 2018-09-22
    174 min

    KAWD-939 Genuine Active Idol Yuki Yatsuda Av Ban While Love Is Prohibited ... Shock Debut

  • yuki yatsudasquirtingsingle workKAWDkawaiiusapyonKAWD-939KAWD939kawd00939
    • 2018-09-09
    89 min

    VEC-324 The Wife Of The Director Is Too Erotic ... Elena Takimoto

  • elena takimotocreampiemature womanVECvenuspe tamegami venusVEC-324VEC324vec00324
    • 2018-07-08
    100 min

    VEC-317 The Manager'S Wife Is Too Erotic ... Kumamiya Yuno

  • yuno kumamiyacreampiemature womanVECvenuskaniemegami venusVEC-317VEC317vec00317
    • 2018-06-17
    119 min

    CJOD-148 Topic Amateur On Adult Posting Video Site! It Was Amazing To Be A Cowgirl Vaginal Cum Shot That Can Be Made 10 Shots By An Absolute Raw Saddle Busty Slut Who Is Excited Only By A Tuna Man

  • amateurcreampiebig titsCJODbichijo hebunCJOD-148CJOD148cjod00148
    • 2018-06-12
    119 min

    HONB-060 Newly 18 Years Old Employment Is Av Actress Haruka Okajima

  • haruka okajimasingle workHONBmercury mercuryshodai shibuya tokubetsu tokkou honbuHONB-060HONB060h-1133honb00060
    • 2018-05-20
    120 min

    DASD-435 "I'M Waiting To Take Off My Clothes." When The Annual Income Exceeds 20 Million Yen, A Wife Who Is Too Cute Gets It And Has A Velocisu Sex Every Day. (Virtual Currency) Minori Henan

  • real village henanbeautiful girlsingle workDASDdasmishima rokusaburoDASD-435DASD435dasd00435
    • 2018-04-14
    149 min

    SSNI-184 Hairless Female College Student Who Was Completely Tied Up And Forcibly Fucked

  • hinana is nonbdsmsingle workSSNIs1 no 1 stylejo styleSSNI-184SSNI184ssni00184
    • 2018-03-09
    485 min

    MZQ-062 Secretly Super-Powerful Aphrodisiac Is Filled And Everyday Frustration Explodes! Regardless Of Where The Horny Married Women Spree Stet 8 Hours Omnibus

  • amateurcreampiebig titsMZQprestigemajikkukuoriteiMZQ-062MZQ062118mzq00062
    • 2017-09-17
    120 min

    OBA-356 Aunt Yura Who Is In Love With Frustration Who Cannot Wait For A Courier

  • yurabig titsmature womanOBAmadonnamiyase hiromichiobasanOBA-356OBA356oba00356
    • 2017-07-07
    175 min

    YMDD-104 Hula Girl Is A School Girl! ? Jk Sprinkled With Hips Trained In Dance Squirting A Lot Of Man Juice! ! Sakura Sakihime

  • sakura sakihimecreampiebig titsYMDDmomotarou eizou shuppanasakusa ga jirojaku momoYMDD-104YMDD104ymdd00104
    • 2016-10-29
    166 min

    CLUB-333 I (♀), Who Is Only Interested In A Cute Girl, Brought A Strange Female Friend Back To The Room And Forcedly Lesbianed To Sneak A Shot 9

  • amateursquirtingCLUBhentai shinshi kurabuCLUB-333CLUB333club00333
    • 2016-10-06
    219 min

    SDMU-372 Magic Mirror Nowadays, The General Parispi Waist Is So Erotic! The Gals With High Vibes 10 People Should Be Only Intercrural Sex, Too Many Experienced People ... I'Ll Get The Momentum And Force Sex! ? In Ikebukuro

  • amateurSDMUsod createhoshi shootmirror noSDMU-372SDMU3721sdmu00372
    • 2016-10-06
    142 min

    SDMU-380 How Many Times Is Reina Kiyomoto Good At Sex For 2 Hours And 20 Minutes?

  • rena kiyomotosquirtingsingle workSDMUsod createminami haouSDMU-380SDMU3801sdmu00380
    • 2014-07-18
    300 min

    CATS-016 Amateur Girl Secret Shooting Av Released As It Is.

  • amateurschoolgirlamateurCATSokubo yankeesCATS-016CATS016h-157cats00016
    • 2012-12-28
    240 min

    SCOP-105 Voyeur Where Ol On A Business Trip Is Excited To Masturbate For The First Time To See Av At The Hotel In The Hotel! If You Pretend To Be Wrong And Intrude Into The Room, The Estrus Ol Will Ask You For The Same!

  • amateuramateurSCOPkm produceeightscoop kmpSCOP-105SCOP105h-565scop00105
    • 2011-03-19
    120 min

    HBAD-139 Marika Marika Who Is Tied To The New Wife'S Father-In-Law And Being Forced To Feel It

  • marikasingle workHBADhibinomurayama kyousukebabeHBAD-139HBAD1391hbad00139
    • 2009-09-20
    142 min

    NHDT-859 The Woman Who Is Looking At The Eyes Even Though There Is A Boyfriend Burns In 2 Seconds The Moment When Only Two Women Are Alone 2

  • amateurNHDTnatural highkariNHDT-859NHDT8591nhdt00859
    • 2009-02-21
    106 min

    NHDT-746 Even Though There Is A Boyfriend, A Woman Who Looks At Her Eyes Burns Up In 2 Seconds When Only Two Women Are Alone

  • amateurhandjobNHDTnatural highNHDT-746NHDT7461nhdt00746
    • 2023-02-23

    DLDSS-162 The Unconscious Temptation Of A Gentle Natural Married Woman Who Is Too Kind And Forgives Anything. Suzume Mino

  • amateurDLDSSdahliamishima rokusaburoDLDSS-162DLDSS162



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free