needs




EBODDASDBLKHDKARBDCJODSDABAUKGROYDSPRDSTARSAVSASHKDSQTECESDGVHMIAANNPJAPODCHRV

2020-12-10
181 min

SW-743 "Cousin! Enjoy Our Grown-Up Body! !! ] And The Cousins Who Reunited After A Long Time, A Really Naughty Temptation! !! !! Of Course, I Inserted A Fully Erected Ji-Po Into A Wet And Wet Mako! !! !! !!

  • amateurSWswitchswitch switchSW-743SW7431sw00743
    • 2020-12-20
    140 min

    HND-928 Tsukino Sakura Is The First Vaginal Cum Shot That Does Not Stop A Rich Kiss

  • tsukino sakuracreampieblowjobHNDhon nakamametaro mamezawaHND-928HND928hnd00928
    • 2020-12-25
    158 min

    BDSM-072 Bondage Guy ● Mrs. Chitose Yura

  • chitose in the eveningbig titsbdsmBDSMtightkaibind maniaBDSM-072BDSM072h-1096bdsm00072
    • 2020-12-25
    234 min

    SKMJ-138 Big Ass Amateur Female College Student Plumply Big Ass Meat Bullet Piston And Legs Jerky! Grab A Fleshy Ass, Lick The Ass Hole, Lick It All The Way, Swing A High-Speed Ass With A Big Ass Intercrural Sex, And Climax In Agony With A High-Speed

  • amateurcreampieamateurSKMJred face girlone topSKMJ-138SKMJ138h-1324skmj00138
    • 2020-12-25
    100 min

    YST-235 A Sober And Gentle Nursery Teacher'S Habit That He Usually Does Not Show Is A Guardian, A Muttsurisukebe Metamorphosis That Can Not Be Said To Colleagues. When You Experience Eroticism In The Brain, You Expose Your Face And Leak It (Laugh) Mi

  • mitsuha higuchicreampieamateurYSTkomyoYST-235YST235540yst00235
    • 2021-01-01
    236 min

    DKSB-094 10 Complete Best Nipple Killers

  • miyu saito narumi sayakablowjobslutDKSBoffice k sk s bestDKSB-094DKSB09436dksb00094
    • 2021-01-09
    120 min

    DASD-795 The Climax Of Professional Guitarist Preparedness. Fingertips That Feel Like A Convulsive Vagina Filled With Sperm. Mizuno Nagisa

  • mizuno nagisacreampiebig titsDASDdasgoemonDASD-795DASD795dasd00795
    • 2021-01-14
    133 min

    SPRD-1365 Even My Mother-In-Law Seems To Be Pregnant. Narimiya Iroha

  • narumiya irohacreampiemature womanSPRDtakara eizohotate ikkanaleddinSPRD-1365SPRD136518sprd01365
    • 2021-01-29
    94 min

    HJ-029 Hidden Camera Ol Complaint Dealing Leakage 2 1/2 ~ Unable To Leave ... Large Incontinence Women Exposing Abomination ~

  • amateurHJbrill jadeperverted video jadeHJ-029HJ029h-921hj00029
    • 2021-02-20
    102 min

    YST-238 I'M Happy Somewhere Even If The Wife Next Door Threatens Me Yuri Honma

  • reallycreampiemature womanYSTkomyoYST-238YST238540yst00238
    • 2021-02-23
    140 min

    SDMM-076 Magic Mirror Mutchimuchi Nursery Teachers Only! "Why Don'T You Let Me Suck Your Boobs And Support The Mother'S Boy'S Departure From Mom?" Soft Breast Sucking Sp

  • amateurbig titsamateurSDMMsod createevening publicationmagic mirrorSDMM-076SDMM0761sdmm00076
    • 2021-03-27
    158 min

    LULU-064 While My Husband Was Assigned To Work Alone, I Loved My Big Tits Aunt'S Dirty Boobs So Much That I Made Vaginal Cum Shot Many Times Until I Got Pregnant At Home Alone 2 Remi

  • remicreampiebig titsLULUlunaticsluminaxLULU-064LULU064lulu00064
    • 2021-04-10
    136 min

    BEFG-001 Woman Tortured-Purgatory Honey-Episode 1: Falling Elite Investigator'S Terrifying Roar Tsubasa Hachino

  • yano tsubasabdsmsingle workBEFGbabyentertainmentkikubongolden babeBEFG-001BEFG001befg00001
    • 2021-04-15
    123 min

    DDOB-092 The Manager Of The Share House Is Unequaled Baba Hitomi Ryo

  • ryo hitomimature womanslutDDOBdogmanormal kimmy auntDDOB-092DDOB092ddob00092
    • 2021-04-18
    130 min

    BLOR-168 Ol Who Seems To Be Unpleasant With A Ripe Body With A Whip Whip An Adult Woman Who Can Afford It Is A Female Of Toro Toro In Front Of An Unequaled Big Cock!

  • amateurbig titsmature womanBLORbroccoli mousouzokubroccolibroccoliBLOR-168BLOR168blor00168
    • 2021-05-07
    120 min

    RCTD-398 Shuraba Catfight

  • ayaka mochizuki hazuki peachlesbianRCTDrocketcentral yamamotoRCTD-398RCTD3981rctd00398
    • 2021-05-28
    135 min

    DIC-087 Impact! Split Tan Ultimate De M [Ultimate Masochist] Snake Tongue Beautiful Girl Av Debut! Active Professional Student [Veterinary Nursing Major] Yuzuki Otoha (20)

  • otoba yuzukisoloworkDICprestigemanhattan kimuradiscoverDIC-087DIC087
    • 2021-06-05
    125 min

    PKPD-146 Enjo Dating Creampie Ok 18 Years Old Shy E-Cup Whip Whip Honor Airi And Half-Middle Half Circumscribed Circle Airi Momose

  • airi momosecreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-146PKPD146pkpd00146
    • 2021-06-11
    180 min

    MIAA-454 Snake Tongue Anaconda Witch Ji Po And Anal Licking Alternately At The Same Time Chablis And Ejaculate Many Times A Ge Le Yumika Saeki Kanno Hana

  • yuka saeki kanna floweranalblowjobMIAAmoodyzkogoro kindaichieveryone s porn starMIAA-454MIAA454miaa00454
    • 2021-06-12
    242 min

    UMSO-397 Exciting Creampie Pregnancy Active Intercourse By Wearing A Super Obscene Costume To A Wife With A Whip Whip Body

  • yuri chitose mizuna wakatsukicreampiebig titsUMSOk m produceumanamiUMSO-397UMSO397umso00397
    • 2021-06-12
    127 min

    USAG-030 Whale Girl Elina (18) Squirting / Teen / Creampie / Gonzo / 3P Sex / 3 Production

  • amateurcreampiebeautiful girlUSAGrabbit daydreamersUSAG-030USAG030usag00030
    • 2021-06-22
    140 min

    SDJS-121 Sod Female Employee 150,000 Rpm (30 Times More Than Before) Super High Speed Electric Vibrator! As A Result Of Challenging The Development Of A New Electric Vibrator While Becoming A Laboratory Table By Himself In Search Of The Most Comforta

  • kotoba nakayama is it satobig titsSDJSsod createmideyesod jouko shainSDJS-121SDJS1211sdjs00121
    • 2021-07-14
    240 min

    KIBD-281 Don'T Miss The Pulsation Of Ji Po On The Verge Of Launch! Demon Gal Fellatio Summary Best3

  • amateuruniformblowjobKIBDkira kiraKIBD-281KIBD281kibd00281
    • 2021-08-06
    120 min

    MEYD-697 I'M Actually Being Raped By My Husband'S Boss ● Luna Tsukino

  • tsukino lunacreampiesingle workMEYDtameike gorooosaki hirokoujiMEYD-697MEYD697meyd00697
    • 2021-08-20
    240 min

    REXD-377 A Trap Charged In Protein! Let'S Finish The Female Body Modification Plan With This!

  • amateurcreampieREXDreddogroupREXD-377REXD377rexd00377
    • 2021-09-18
    120 min

    AQSH-076 Miki Matsuzaka, The Female President Who Was Treated As A Meat Urinal Even By A Subordinate Who Was Stupid After Being Made To Do A Big Job By A Delivery Health Bite By A Man Of A Business Partner Who Was Flirting

  • miki matsuzakacreampiemature womanAQSHaqua mall heroaqua mallAQSH-076AQSH076aqsh00076
    • 2021-09-25
    131 min

    HMGL-188 Embarrassing Body Black Sun Yumika Saeki

  • yuka saekimature womandeepthroatHMGLhmjmcompany matsmaglamourHMGL-188HMGL188h-172hmgl00188
    • 2021-09-24
    190 min

    URE-071 Naruto Chuka: Original Female Teacher Reiko ~ Aphrodisiac Class ~ Drowning A Strictly Beautiful Lady In Pleasure! !! Marina Shiraishi

  • rena shiraishimature womansingle workUREmadonnakitorune kawaguchiure komiURE-071URE071ure00071
    • 2021-09-24
    102 min

    YSN-560 I Have A Child Who Is Famous For Being Cute In My Neighborhood. Mitsuki Nagisa

  • scoopingcreampiedeepthroatYSNnonYSN-560YSN560h-127ysn00560
    • 2021-10-15
    150 min

    BLK-526 Yeah! Who Do You Want To Be The Best With? Trance Dirty Words That Make Your Brain Haji And Harlem Temptation That Goes Crazy Until You Become Stupid! After All, A Gal Is ... Great! !! Aoi Kururugi Noa Eikawa Hana Hana

  • aoi kururugi sakaegawa noauniformslutBLKkira kirasamoarikira hosi kira black galBLK-526BLK526blk00526
    • 2021-10-20
    89 min

    SPZ-1117 How Far Can You Do It! ?? Men'S Esthetic Whip Butt Older Sister

  • amateurbig titsSPZstar paradisesuta paradaisuSPZ-1117SPZ1117h-254spz01117
    • 2021-11-11
    121 min

    GUN-865 Overdo It! Pee Sister Mao Watanabe

  • mao watanabesingle workGUNradixsakuraba kyuu kokoro otokobatsugunGUN-865GUN865433gun00865
    • 2021-11-13
    119 min

    JLZ-053 Sixtieth Birthday Lesbian Chairman'S Wife And President'S Wife Ruriko Kanda Shiho Satsuki

  • ruriko kanda shiho satsukilesbianmature womanJLZrubytsuji koujikuroyuriJLZ-053JLZ053jlz00053
    • 2021-11-20

    SIRO-4692 [First shot] [Neat and clean beauty with a boyfriend] [Transcendence sensitivity of the generalized

  • amateuramateurSIROshiroutotvSIRO-4692SIRO4692
    • 2021-11-19
    120 min

    HMN-078 ♯Aoharu. Youth Child Making Sex Amano Ao Who Seriously Fell In Love With A Uniform Beautiful Girl And Made Vaginal Cum Shot

  • ao amanocreampiebig titsHMNhonnakakubo styleHMN-078HMN078hmn00078
    • 2021-12-20
    89 min

    YOZ-389 Mature Woman Deriheru Raw Production Negotiations

  • sakisui ran yamabukicreampiemature womanYOZstar paradiseyaozokuYOZ-389YOZ389h-254yoz00389
    • 2022-01-21
    120 min

    JUL-845 Exclusive · Masayu Onodera!! The Smile Of The Angel Gets Strangely Wet With Pleasure, And Has Fallen In Agony With The Climax Again And Again!! Close Contact Cum Shot Sex-Unfaithful Copulation That Makes Up Loneliness With Her Husband'S Boss-

  • mayu onoderamature womansingle workJULmadonnarokusaburo mishimaJUL-845JUL845jul00845
    • 2022-01-22
    130 min

    CMC-268 Enema Slave Sisters In The End Of A Square Relationship

  • miho tomii kotori shimaanalsisterCMCcinemagicshinichi kawamuracollectCMC-268CMC268cmc00268
    • 2022-01-28
    120 min

    MIDV-046 Until Morning Giant Unequaled Ji ○ Port Seeding Press Big Screaming Portio Destruction Confined A Delicate Slender Married Woman Who Put A Claim In The Trash Room Of Annoying Neighbors Les × Pu Aime Mizuki

  • mizuki aicreampiedeepthroatMIDVmoodyzmoodyz divaMIDV-046MIDV046midv00046
    • 2022-03-05
    130 min

    MDS-901 “I Want All The Semen In My Mouth And Vagina” Looking For A Sensitive Man With A Matching App, Bring Him To His Home And Have A Nest Sexual Intercourse! Obscene School Girls Who Love Rich Semen Himari Kinoshita

  • himari kinoshita himari hanazawacreampieblowjobMDSuchu kikakusamoariMDS-901MDS901mds00901
    • 2022-04-09
    145 min

    DNJR-072 A Little Devil Who Loves The Patience Face Of A Man Who Is Stopped By Dimensions And Can'T Be Squid Her Ejaculation Management Diary Tennen Mizuki

  • natural mizukislutsingle workDNJRdog daydreamersmaboroshikoDNJR-072DNJR072dnjr00072
    • 2022-05-01

    TSM-33

  • amateurTSMlahaina tokaitoukyou seifuku maniaTSM-33TSM33
    • 2022-04-30
    151 min

    DLPN-018 Big Ass Anal Wife 3 Hole Fuck Mikako (38) Anal Fuck/Deep Throating/Big Ass/Big Tits/Masochist/Healing

  • amateurdeepthroatDLPNdolphin emanieliruka emmanuelDLPN-018DLPN018dlpn00018
    • 2022-05-12
    115 min

    ZEAA-73 Kanto Married Woman Training Circle Ryoune (35 Years Old) Manaka Ryoune

  • amateurbig titsmarried womanZEAAcenter villagekinggoku centervillageZEAA-73ZEAA73h-086zeaa73
    • 2022-05-20
    120 min

    HMN-178 Secretly Fucking Cum Shot Sex Behind The Scenes With My Childhood Friend'S Busty Older Sister Who Bullies Me Every Day! Kohana No Non

  • floretscreampiebig titsHMNhonnakamamezawa mametarouHMN-178HMN178hmn00178
    • 2022-06-04
    126 min

    EVIS-410 Lesbians Licking Each Other With Inflated Erection Nipples

  • kagami sara aya shiomibig titslesbianEVISebisusan mousou zokumr tarotEVIS-410EVIS410evis00410
    • 2022-06-10
    120 min

    JUL-881 I'M Not Satisfied With My Husband... Married Woman Shirahana Who Fell Into A Big Cock Store Manager

  • hakuhanamature womansingle workJULmadonnakitorune kawaguchiJUL-881JUL881jul00881
    • 2022-06-10
    130 min

    SSIS-427 2 Hours Until The Last Train Who Has Cheating Sex With The One And Only Mistress Who Has The Most Disgusting Meaty Body

  • kaoru yasuibig titsblowjobSSISs1 no 1 stylearashiyama michiruSSIS-427SSIS427ssis00427



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free