h_796san00167




VEMAADNBLKSDABMIAAMARAFSDSSMILKIPXWANZVENUEBODCHRVGVHCAWDDASDATIDSPRDMIDEMEYD

2021-05-21
120 min

CAWD-213 M Woman Specialized Deriheru A Younger Female Boss Who Hates Looking Down When You Call Me ... Completely Obeyed And Speared Until An Antibody Was Made Reversal Of Position ● Mayuki Ito

  • maiyuki itocreampiedeepthroatCAWDkawaiizaku araiCAWD-213CAWD213cawd00213
    • 2021-05-28
    240 min

    BMW-235 Brutal Deep Throating Best

  • bud juliadeepthroatBMWwanz factorywanzBMW-235BMW235bmw00235
    • 2021-06-05
    91 min

    VENX-043 Mother And Son Usui Ren, Whose Father Goes Out And Has Sex In 2 Seconds

  • usui rencreampiebig titsVENXvenuskaniefakecest winntersVENX-043VENX043venx00043
    • 2021-06-05
    139 min

    PKPD-147 Msgk Unauthorized Mr. Nakata Enko Menhera Mine-Based Idol Girl Kurumi-Chan (18) & Sns Sexual Beast Girl Ami-Chan (18)

  • hyakuta walnut ami kashiwagicreampieschoolgirlPKPDfuck group and fun friends daydreamersPKPD-147PKPD147pkpd00147
    • 2021-06-11
    120 min

    MIDE-937 5 Days Tsundere Cohabitation Life With A Cheeky Childhood Friend Rikka Ono

  • rokka onobeautiful girlsingle workMIDEmoodyztake dmoodyz divaMIDE-937MIDE937mide00937
    • 2021-06-11
    180 min

    MIDE-941 Aoi Tsubasa, A Pursuit Handjob Men'S Esthetic That Makes You Ejaculate Absolutely Continuously With A Divine Hand Tech

  • tsubasa aoihandjobsingle workMIDEmoodyzkyoseimoodyz divaMIDE-941MIDE941mide00941
    • 2021-06-16
    120 min

    SSIS-095 Targeted By Track And Field Enthusiasts ... Uniform Girl Izuna Maki Exposed To A Bizarre Voyeur Video Of A Sticky Stalker

  • izuna makischoolgirlsingle workSSISs1 no 1 stylegoemonSSIS-095SSIS095ssis00095
    • 2021-06-20
    140 min

    APKH-178 # Back Dirt Daddy Activity Uniform Invited By My Daughter Off Paco Hot Spring Trip Gonzo Miyazaki Rin

  • miyazaki rincreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-178APKH178apkh00178
    • 2021-07-01
    164 min

    SHIND-011 Adhesive Stalker M Train Slut ● ・ Home Invasion Record # 21 ・ 22

  • amateuramateurSHINDshinkiromirage mirageSHIND-011SHIND011h-1560shind00011
    • 2021-07-22
    107 min

    HTHD-188 Friend'S Mother-Final Chapter-Original

  • osamu osamucreampiemature womanHTHDcenter villagejiro fukagawahona zonoHTHD-188HTHD188h-086hthd00188
    • 2021-07-22
    150 min

    WAAA-083 "Let'S Exchange Whether Your Student Or My Student'S Ass Is Sensitive And Feels Good." Ikase Match Momojiri Swap (Exchange) Until The Two Collapse And Fall, Cum Shot In The Back Piston Marina Saito Suzu Takayama

  • marina saito takayama tincreampieschoolgirlWAAAwanz factorywanzWAAA-083WAAA083waaa00083
    • 2021-08-06
    180 min

    HJMO-469 Beautiful Big Ass Married Woman Is A Fixed Dildo Guessing Game Dominant Rod Ippon Game! If You Hit It Perfectly, The Prize Will Be 1 Million Yen! If You Remove It, You'Ll Get A Big Cock On The Spot! Sensitive Ma ● Immediately After Getting A

  • amateursquirtingHJMOhajime kikakujohann yuanHJMO-469HJMO469hjmo00469
    • 2021-08-20
    150 min

    JUL-691 Maiko Ayase Invite Her Mother-In-Law Who Wants Her Son-In-Law'S Big Cock

  • maiko ayase maria sawaguchimature womanslutJULmadonnakindaichishougo rouJUL-691JUL691jul00691
    • 2021-09-03
    120 min

    CAWD-283 Sauna Return Shared Room Ntr Unequaled Sexual Intercourse With The Manager Of A Part-Time Job Who Listens To His Complaints That Becomes A String Asuka Momose

  • momose asukacreampiesingle workCAWDkawaiiarashiyama michiruCAWD-283CAWD283cawd00283
    • 2021-09-24
    134 min

    SKMJ-209 * Minors * No Condoms * 19-Year-Old Lewd Hot Spring Trip * 4 Production

  • amateurcreampieamateurSKMJsekimenjoshikantori wajimasekimen goshiSKMJ-209SKMJ209h-1324skmj00209
    • 2021-10-01
    165 min

    DOCP-322 "I'll Just Rub It!? ... Then I'll Give You A Special Training." I've Improved Premature Ejaculation With Her Gon Attack Blowjob.

  • satsuki ena kitano yunaDOCPprestigedoc premiumDOCP-322DOCP322
    • 2021-11-12
    122 min

    FOCS-032 No.1 Beauty Sugiru Nomination In Tokyo Gonzo With Slender Beauty Body And Outstanding Technique × W Blow × 3P Highest Quality Service To You ...

  • squidblowjobhandjobFOCSabc mousou zokufocusFOCS-032FOCS032focs00032
    • 2021-11-19
    120 min

    HMN-086 The Back Face Of A Female Boss That Only I Know. A Fierce Belokis Vaginal Cum Shot After A Date That Kept Being Impatient Until The Rod Became Stupid With A Terrible Jupofera 200 Days After That Personnel Department: Yumika Chief Yumika Saeki

  • yuka saekicreampieblowjobHMNhonnakarassha miyoshiHMN-086HMN086hmn00086
    • 2021-11-26
    140 min

    IBW-850z The Dark Brown Half-child Is Don Pishari Run 145cm

  • sakita ranbeautiful girlIBWi b worksIBW-850IBW850
    • 2021-12-09
    302 min

    SVOMN-173 111 Barrage Of Big Ass That Is Vulgar About Egg!

  • amateurcreampiesquirtingSVOMNsadistic villagesaddy bestSVOMN-173SVOMN1731svomn00173
    • 2021-12-09
    142 min

    RCTD-437 When I Missed The Last Train And Stayed At The House Of The Gal Boss, I Was Nuka With 12 Shots/10 Rubbers In A Row! Hidou Ria

  • riria hidoslutsingle workRCTDrocketroot yamazakiRCTD-437RCTD4371rctd00437
    • 2021-12-10
    170 min

    BANK-064 Vaginal Cum Shot Open-Air Hot Spring Slim Busty'S Strongest Kubire! Pink Areola & Pink Nipples Dirty Nasty Snake Tongue Bitch

  • amateurcreampiebig titsBANKma ko ginkoutakechanBANK-064BANK064h-1495bank00064
    • 2021-12-23
    124 min

    FSDSS-340 Ji Po, The Convenience Store Manager Who I Hate A Lot, Was Do-Strike... I Was Squid To Die And Was Circled By All The Bytes ● Momo Honda

  • honda peachsingle workFSDSSfalenoflagmanfaleno starFSDSS-340FSDSS3401fsdss00340
    • 2021-12-24
    125 min

    ZKWD-020 After School Meat Urinal 20Th Person Nozomi Hironaka

  • hironaka nozomicreampiebig titsZKWDtoyohikozarakiseiunkaiZKWD-020ZKWD020zkwd00020
    • 2022-01-08
    144 min

    EKDV-674 This Female Woman... Is In Full Estrus Right Now! Why Don'T You Try It As Mori Hinako?

  • hinako moricreampieblowjobEKDVcrystal eizopearl rice sakagamie kissEKDV-674EKDV674ekdv00674
    • 2021-12-27
    71 min

    NAPK-010 Nampaco No.10 Picking Up A Slender Dental Assistant Of No Bra Knit On The Way Home At The End Of The Morning Medical Examination And Continuously Vaginal Cum Shot!

  • minami irohacreampieNAPKfirst starnanpakoNAPK-010NAPK010
    • 2022-01-21
    120 min

    JUL-845 Exclusive · Masayu Onodera!! The Smile Of The Angel Gets Strangely Wet With Pleasure, And Has Fallen In Agony With The Climax Again And Again!! Close Contact Cum Shot Sex-Unfaithful Copulation That Makes Up Loneliness With Her Husband'S Boss-

  • mayu onoderamature womansingle workJULmadonnarokusaburo mishimaJUL-845JUL845jul00845
    • 2022-01-27
    125 min

    AARM-055 Masturbation Instructions 2 While Watching The Face And Ji Po Alternately In Erotic Poses

  • maki kyoko arimura nozomianalslutAARMaroma planningmania satoshiaromaAARM-055AARM055aarm00055
    • 2022-01-28
    130 min

    ATID-499 A Girl From The Neighborhood Who Said “I'M Going To Marry An Old Man” Got Married. When I Was Betrayed, I Did A Seed Press Training Until She Was Confined Without Forgiveness And Conceived. Amane Yui

  • amane yuicreampiebeautiful girlATIDattackersjo stylein madATID-499ATID499atid00499
    • 2022-01-29
    120 min

    GVH-356 A Lascivious Wife Who Provokes Her With No Bra And No Panties Has Moved In Next Door! Florets

  • floretsslutsingle workGVHglory questkabin kizakuraGVH-356GVH356gvh00356
    • 2022-02-04
    140 min

    ROE-046 My Beloved Mother Who Continued To Protect Me From My Colleagues At Work -. Kamine Yukika

  • yukika kaminecreampiemature womanROEmadonnaunicorn fukudamonroeROE-046ROE046roe00046
    • 2022-02-05
    240 min

    NASH-645 Black Giant Mara Criminal ● 4 Japanese Mature Women Who Writhe 4 Hours

  • shota chisato kozue tokitamature womanNASHnadeshikoNASH-645NASH645nash00645
    • 2022-02-11
    120 min

    PPPE-008 Her Older Sister Seduces Me With Big Breasts And Vaginal Cum Shot Ok Sumire Mizukawa

  • mizukawa violetcreampiebig titsPPPEoppaiPPPE-008PPPE008pppe00008
    • 2022-02-12
    125 min

    BIJN-216 The Document Instinct Bare Climax Sex Baby-Faced Nikkan H Cup Bristle Amazing Nasty Yariman Libido Monster Mei Hosho

  • mei hoshobig titssingle workBIJNbijin majo emmanuelleBIJN-216BIJN216bijn00216
    • 2022-02-18
    120 min

    HMN-122 Ban Lifted 20 Years Old Fashionable & Cute Clothing Professional Student Wearing Av Horny Cosplay For The First Time In Raw Cum Shot Shiki Mina

  • shiki mainacreampiecosplayHMNhon nakamametaro mamezawaHMN-122HMN122hmn00122
    • 2022-02-19
    144 min

    HOMA-114 Shared Room Ntr Hirose Riona With My Female Boss Who Has Been Longing For Since I Joined The Company At A Business Hotel On A Business Trip

  • rio hirosecreampiesingle workHOMAh m p doramahimu lockHOMA-114HOMA114homa00114
    • 2021-11-04
    104 min

    YAHO-020 Miyu

  • miyu 20creampieslutYAHOamateur yahooyaho020YAHO-020YAHO020yaho020
    • 2022-02-25
    150 min

    WAAA-148 The Condom Is Torn And It'S A Bareback! Vaginal Cum Shot Many Times With A Super Accelerating Piston! Yuki Rino

  • yuki rinocreampiebig titsWAAAwanz factorywanzWAAA-148WAAA148waaa00148
    • 2022-03-05
    147 min

    DVAJ-562 Nanami Kawakami, The Older Sister Of A Personal Trainer Who Continues To Slowly Commit Me Who Is A Beginner At The Gym And Is Helpless

  • kawakami nanamicreampieslutDVAJalice japanbieber gonzoDVAJ-562DVAJ562dvaj00562
    • 2022-03-24
    130 min

    SDMU-984 I Can't Forgive A Popular Female Gym Trainer Banning Me As A Guest! I'll Do What I Want With A Brainwashing Esthetic! Chanyota

  • takarada arisa chanyotaSDMUsod createmoroboshi ichitaroSDMU-984SDMU984
    • 2021-06-30

    MFC-119

  • amateurMFCmoon forceMFC-119MFC119
    • 2022-04-01
    180 min

    CAWD-353 Will Control Your Five Senses Asmr Shikoshiko Great Techonasapo Wrapped In Maiyuki Ito

  • maiyuki itocreampiehandjobCAWDkawaiibungo maedaCAWD-353CAWD353cawd00353
    • 2022-04-16
    133 min

    KYMI-022 Dirty Words ● Self-Portrait Shooting Clothed Slutty Empress Yuzu Tsubaki Ryo

  • emperor yuzu ryo tsubakislutKYMImiruyumeno aidaKYMI-022KYMI022kymi00022
    • 2022-04-15
    240 min

    MUCD-259 Graduation Sex Pies Last Before Graduation

  • ishihara hope ichika matsumotocreampieuniformMUCDmukuMUCD-259MUCD259mucd00259
    • 2022-04-21
    113 min

    SW-844 What Should I Do If I Get Caught? I Hid With My Sister'S Female Friend And Secretly Had Sex!

  • amateurschoolgirlSWswitchlight fujimaswitch switchSW-844SW8441sw00844
    • 2022-04-23
    136 min

    APAK-223 [Beautiful Huge Breasts, De Nasty] Carnivorous Sex Where Ma Ko And Ji Po Scream! Extreme Gachihame Close Contact Shooting That Makes An H Cup Nasty Gal Who Blames Her Ikase Fallen! Oto Alice

  • otsu alicecreampiebig titsAPAKaurora project annexrkaurora project anexAPAK-223APAK223apak00223
    • 2022-05-02

    EROFC-047

  • amateurEROFClove girlfriendEROFC-047EROFC047
    • 2022-05-05
    121 min

    MILK-144 The Secret Relationship Between An Underground Idol And An Otaku I'M Playing Off Paco Normally With Fans W Vaginal Cum Shot Ok Cosplay Sex Crazy 4 Production Sumire Kuramoto

  • sumire kuramotocreampiecosplayMILKmilkMILK-144MILK144h-1240milk00144



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free