h_706prbyb00094




AVSADTTHZGDWAAAATIDJUFEVEMAHNDMILKMIAAFSDSSAWDPPPDMEYDNGODLULUMIDEBLKVENXWANZ

2021-02-22
145 min

DAYA-015 [Personal Shooting] Sweet And Soggy Dirty Talk Play With Big Tits Dirty Sister Miina Wakatsuki

  • miina wakatsukibig titsblowjobDAYAdigital arkaida yumenodigital ark digital arkDAYA-015DAYA015daya00015
    • 2021-03-01
    189 min

    HR-005 Chibiya Ennui Beautiful Wife Ayaka Muto Ayaka Twisted Her Vulgar Nipples

  • ayaka mutoamateursingle workHRplumhimu lockshirouto only plumHR-005HR005h-113hr00005
    • 2021-03-06
    140 min

    NKKD-198 Hana Haruna, A Busty Daughter-In-Law Who Was Treated With A Masseuse'S Decachin And Opened To The Public

  • haruna hanamature womansingle workNKKDjet eizomanji groupNKKD-198NKKD198nkkd00198
    • 2021-03-19
    107 min

    MBDD-2053 Shoko Takahashi / The Temptation Of Emeralds

  • shoko takahashibeautiful girlsingle workMBDDmedia brandMBDD-2053MBDD2053301mbdd02053
    • 2021-03-21
    170 min

    CJOD-287 Sober Glasses Big Breasts Fleshy Whip Whip It Is Sandwiched Between The Body And It Is Squid Many Times W Adhesion Boobs Unlimited Ejaculation Soap Nanami Matsumoto First Love Nene

  • nana matsumoto first lovecreampiebig titsCJODchijo heavenmametaro mamezawaCJOD-287CJOD287cjod00287
    • 2021-04-06
    132 min

    KIRE-033 Cum 52 Times Iki 3 Production! !! H Cup Ripe Body Has Extreme Convulsions! !! Yumi Narisaki 46 Years Old When The Active President Is Rubbed By A Younger Man

  • grace narisakibig titsmature womanKIREsod createyosukebeauty kirei sodKIRE-033KIRE0331kire00033
    • 2021-04-10
    133 min

    BADA-014 "It'S Revenge On My Husband Kuzu ... Lol", A Beautiful Young Wife Applied For Av Shooting, So I Tried To Conceive It With A Large Amount Of Vaginal Cum Shot.

  • amateurbeautiful girlBADAbaltandaibutsu yoshidadiamondBADA-014BADA014bada00014
    • 2021-04-23
    160 min

    JUFE-283 M Man Subjective Gonzo Shooting! W Small Devil Beautiful Girl Is Angry Until The Man Tide Blows! !! Wan Horikita Marina Saito

  • horikita wan marina saitosquirtingschoolgirlJUFEfitchsamoariJUFE-283JUFE283jufe00283
    • 2021-04-24
    180 min

    EMBZ-226 Breast God Advent 2 Boobs X "Kozue Tokita" X Tits

  • kozue tokitabig titsmature womanEMBZjukujojuku emmanuellejukujo jukuEMBZ-226EMBZ226embz00226
    • 2021-05-22
    134 min

    GENM-081 First Av Shooting Hoshi Shino Sera

  • hoshi shino serahandjobsingle workGENMgenekigoldfish dGENM-081GENM081genm00081
    • 2021-03-06
    43 min

    HHKL-088 My Parents Don'T Know My Sister And Younger Brother Secret Physical Relationship Select.1 Himari Kinoshita

  • himari kinoshita himari hanazawacreampiesisterHHKLhunterrobby kunhhh groupHHKL-088HHKL088hhkl00088
    • 2021-06-16
    120 min

    PPPD-937 Maron Natsuki, A Luxury Underwear Maker Directly Managed By A God Slender Busty Older Sister Who Lets You Ejaculate For An Unlimited Amount Of Time

  • marin natsukibig titsslutPPPDoppaiPPPD-937PPPD937pppd00937
    • 2021-06-29
    124 min

    SAN-008 A Polite Woman'S Customs Interview Document Deceived By A Vicious Store Manager Nozomi Higashi

  • nozomi higashisingle workSANmothermother motherSAN-008SAN008h-796san00008
    • 2021-07-09
    180 min

    MIDE-951 Continuous Vaginal Cum Shot Ok Even In The State Of "I'M Already Ejaculating" Pursuit Man Tide Ok Rejuvenation Beauty Treatment Salon Ishihara Nozomi

  • ishihara hopesluthandjobMIDEmoodyzkyoseimoodyz divaMIDE-951MIDE951mide00951
    • 2021-07-18
    130 min

    KATU-085 Nipple Bottle Bottle Dosukebe Snack Mama Big Breasts Big Ass Shaved Muchimuchi Slut

  • amateurbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-085KATU085katu00085
    • 2021-08-20
    240 min

    REXD-377 A Trap Charged In Protein! Let'S Finish The Female Body Modification Plan With This!

  • amateurcreampieREXDreddogroupREXD-377REXD377rexd00377
    • 2021-08-21
    148 min

    APKH-184 Beautiful Girl And Seeding Love Hotel It Seems That Pubic Hair Is Unpleasant Though It Has A Cute Face! Individual Shooting Gonzo That Recorded An Immoral Relationship With An Older Favorite Girl Student Who Pleads For Vaginal Cum Shot. Taka

  • takayama tincreampieschoolgirlAPKHaurora project annexhAPKH-184APKH184apkh00184
    • 2021-08-31
    120 min

    SAN-016 The Best Cuckold! Get That Body Again In Three Days Without A Husband! Rina Takase

  • rina takasecreampiebig titsSANmazakisakura kabinmother mazaSAN-016SAN016h-796san00016
    • 2021-09-04
    160 min

    LULU-093 When I Missed The Last Train At A Company Drinking Party And Stayed At The House Of A Junior Female Employee With A Big Ass, I Was Made To Ejaculate Many Times Until I Got To Work The Next Morning Because Of Premature Ejaculation Of Big Cock

  • tamaki walnutcreampiebig titsLULUlunaticsruminakkusuLULU-093LULU093lulu00093
    • 2021-09-20
    74 min

    FUFU-201 Memoir Zero Cheating Experience If You Trick Your Serious Wife Into Taking Care Of Your Friends And Let Them Argue With You Alone ... Ran Yamabuki

  • ran yamabukiamateursingle workFUFUstar paradisefuufuFUFU-201FUFU201h-254fufu00201
    • 2021-09-17
    120 min

    BLK-521 I Feel More Like You Than A Man Who Blames Me For Being Alive Mei Satsuki

  • satsuki meicreampiebig titsBLKkira kirasamoarikira hosi kira black galBLK-521BLK521blk00521
    • 2021-09-17
    120 min

    MIDE-973 Reversal Of Position! Investigator Fumika Nakayama Fumika Who Continued To Be Violated By Overwhelming Zako

  • nakayama fumikabig titssquirtingMIDEmoodyzkyouseimoodyz divaMIDE-973MIDE973mide00973
    • 2021-09-25
    150 min

    APKH-187 Dirty Little Beauty Big Breasts Uniform Beautiful Girl And Rich Semen Love Hotel Tsuji Sakura Innocently Insults Older

  • sakura tsujicreampiebig titsAPKHaurora project annexhAPKH-187APKH187apkh00187
    • 2021-10-07
    120 min

    HBAD-598 My Sister Always Seduces Me With H Cup Big Breasts, So I'M Already At The Limit Of Patience ... Riho Takahashi

  • riho takahashibig titssisterHBADhibinorokutanzono seishibabeHBAD-598HBAD5981hbad00598
    • 2021-10-16
    141 min

    DDOB-098 Dangerous Mama'S M.G.T Machine Gun Handjob & M.G.I Machine Gun Dirty Talk Chisato Shoda

  • shota chisatomature womanslutDDOBdogmatenunore no obasanDDOB-098DDOB098ddob00098
    • 2021-10-23
    241 min

    SGSR-288 Honmadekka! ?? Av Really Shocking Situation # The Decisive Moment My Daughter Witnessed! # Father Whose Mother Is Cuckold By A Young Man # Raw Squirrel To The Daughter Of The Boss # Wife In The Neighborhood Who Appeared In Av # Woman Showing

  • amateurcreampiebig titsSGSRbigmorkalsakaegyou chuushin sen kumiSGSR-288SGSR28857sgsr00288
    • 2021-10-29
    120 min

    MIAA-516 Suddenly Street Corner Restraint Nipple Transformer Bdsm Restrain You So That You Can Not Move And Knock Down The Nipple Agel Satsuki Mei Tsukino Kasumi

  • satsuki mei kasumi tsukinocreampiebig titsMIAAmoodyzsamoariminna no kikatanMIAA-516MIAA516miaa00516
    • 2021-11-06
    240 min

    BRTM-038 Breeding Record Of Two Female Dogs

  • amateuranalbdsmBRTMk m producepermablack real burakku rearuBRTM-038BRTM038brtm00038
    • 2021-11-20
    124 min

    AGMX-099 Naked Men'S Esthe Ebisu Store

  • maki kyoko rumi tadamibig titsAGMXsex agentusubashi suiAGMX-099AGMX099agmx00099
    • 2021-12-10
    150 min

    DASD-945 The Dispatched Masseuse Touched The Terrible Secret Part Too Much, And I Could Not Bear The Pleasure And Fell Asleep. Maron Natsuki

  • marin natsukibig titssingle workDASDdasrokusaburo mishimaDASD-945DASD945dasd00945
    • 2021-12-11
    120 min

    MDS-898 Daddy, Mom, I Have My Old Man Feel Good Every Day In The Distance. Yuzu Shirakawa

  • yuzu shirakawacreampiebeautiful girlMDSuchu kikakujohnny shibuyaMDS-898MDS898mds00898
    • 2021-12-20
    180 min

    KIR-050 How To Have Sex By Grasping The Weakness Of A Beautiful Office Lady Boss 180 Minutes

  • asagiri hikari tomoe nakamuracreampiebig titsKIRstar paradisekirei star paradiseKIR-050KIR050h-254kir00050
    • 2021-12-25
    240 min

    SCOP-750 You'Re Asleep, But There'S No Way You Can'T Get Out Of Your Hands! Night ● I Sex240 Minutes Best ~ 33 Pairs Of Men And Women Who Could Not Stand ~

  • amateurcreampieSCOPscoopk taromousouzokuSCOP-750SCOP750scop00750
    • 2022-01-05
    120 min

    NACR-495 My Mother-In-Law Is My Virgin Sex Education Sumire Mihara

  • mihara sumirebig titsmature womanNACRplanet plussakura ninshichi ku ryuuNACR-495NACR495h-237nacr00495
    • 2022-01-01
    240 min

    BUR-584 Transcendent Cute Rota ● Data Beautiful Girl Limited Cum Shot Sexual Intercourse 12 People 4 Hours

  • hanaoto urara miyazaki rincreampiebig titsBURglayzburst gureizuBUR-584BUR58412bur00584
    • 2020-04-20
    155 min

    FCDC-117 Bukkake Plump Big Tits Big Ass Secretary Is A Perverted Lewd Slut Nina Nishimura Who Seduces Employees

  • nina nishimurabig titsslutFCDCweekenderFCDC-117FCDC117fcdc00117
    • 2022-02-04
    205 min

    BAZE-009 Support At Lunch Time Without Telling The Company ● Vaginal Cum Shot To A Beautiful Office Lady Who Earns Money With Sex 06

  • amateurcreampiebig titsBAZEbazookatetBAZE-009BAZE009baze00009
    • 2021-08-01
    101 min

    BUBB-108 By All Means Stairs School Girls # 4

  • amateuruniformschoolgirlBUBBeitentatsuzo fujidabukatsudoBUBB-108BUBB108436bubb00108
    • 2022-02-10
    128 min

    GUN-872 Fully Open Nose Hook Planer

  • amateurGUNradixshio sakurabaexceptionalGUN-872GUN872433gun00872
    • 2022-02-18
    120 min

    SSIS-332 “If I'M Horny, I'Ll Ask That Girl To Suck It” Immediate Scale Fellatio Loves Honor Student Who Does Not Know To Refuse Mai Shiomi

  • mai shiomiblowjobbeautiful girlSSISs1 no 1 stylesuisei akaiSSIS-332SSIS332ssis00332
    • 2022-03-19
    120 min

    LUNS-098 Immoral Copulation Of The 60Th Birthday 17

  • amateurcreampiemature womanLUNSluna shunkoshaLUNS-098LUNS098luns00098
    • 2021-04-22

    GCB-011

  • amateurGCBgood bye cherryboythe first time is an av actressGCB-011GCB011
    • 2022-04-01
    480 min

    DCX-136 "Do You Like A Naughty Older Sister ...?" 40 Frustrated Older Beauties Are Monopolized! !! Vaginal Feeling MAX Soggy Fuck BEST 8 Hours

  • amateurslutDCXdocdoc maxDCX-136DCX136
    • 2022-04-01
    210 min

    CLUB-674 When I Was Watching Av At A Loud Volume, A Beautiful Wife From A Neighbor Came To Say A Complaint, So I Was Lustful When I Show Off A Full Erection Big Penis, So I Let My Husband Who Is Answering Her Wife'S Cum Voice 8

  • amateurcreampieCLUBhentai shinshi clubCLUB-674CLUB674club00674
    • 2022-04-07
    125 min

    DRPT-010 Ten Hasumi, A Small Girl Who Is Stripped Naked In A Kappa While Being Struck By Rain And Secretly Made To Live Many Times During Volunteer Activities

  • hasumitencreampiesquirtingDRPTdennou rasputinabusan abusanDRPT-010DRPT0101drpt00010
    • 2022-04-08
    60 min

    FTHT-057 [Can You Watch Me Masturbate? 02] Eh?? Didn'T You Just Look At It? Fetishpetit Video Content By Fare No Chubu

  • amateurbig titshandjobFTHTfaleno tubedavielfalenotubeFTHT-057FTHT0571ftht00057
    • 2022-04-23
    239 min

    OKAX-841 Thigh Shot Girls Who Have Been Bukkake With Plenty Of Hot Semen With A Super Chick Thigh Job

  • yukari miyazawa satori fujinamislutOKAXk m produceokazuOKAX-841OKAX841okax00841
    • 2022-05-09
    94 min

    ACZ-107 How To Raise A Compliant M Girl Who Taught The Goodness Of Vaginal Cum Shot Sex To Yin Kya Daughter “Nanami” With One Male Experience 04

  • amateurcreampieschoolgirlACZsanwa publishingACZ-107ACZ107h-019acz00107



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free