h_1664nxg00442




APODAVSAMEYDMVSDCAWDATIDONEZDTTAMBIEBODSTARSPPPDSANSHKDMIAAMIDEVEMAAWDBBANHND

2021-05-08
110 min

VENX-035 I'Ve Got An Erection When My Daughter-In-Law'S Mother, Who Has Begun To Worry About Her Plump Mature Woman'S Body, Is Ashamed Recently.

  • nene tanakacreampiebig titsVENXvenusmajime kitanofakecest winntersVENX-035VENX035venx00035
    • 2021-05-22
    149 min

    GMEM-032 Ultra Sweet Akakai Captive Beautiful Girl Warrior Toying Training Small Devil Bombing Panic Hell Natsu Tojo

  • natsu tojosingle workGMEMavs collector sbaba za babbyavscollector s goldGMEM-032GMEM032gmem00032
    • 2021-06-12
    120 min

    SABA-701 Completely Subjective Sex By Skipping Work With A Senior Of A Longing Company Sex Major Consumer Finance Work Nozomi, 34 Years Old, 12 Years After Joining The Company

  • amateurcreampieSABAskyu shirototodoSABA-701SABA701saba00701
    • 2021-06-12
    120 min

    NSPS-999 Super Humiliation! !! Wife 2 Mitsuha Higuchi Who Has Been Made Into A Toy For Everyone On A Company Trip

  • mitsuha higuchisingle workdramaNSPSnagae stylenagaeNSPS-999NSPS999nsps00999
    • 2021-06-30
    136 min

    GVH-253 Sex Appeal Pa Chairman And Bad Boy Student Organization Chitose Yura

  • chitose in the eveningbig titssingle workGVHglory questhyonGVH-253GVH25313gvh00253
    • 2021-07-09
    120 min

    IPX-683 Even Though My Lover Was Waiting At Home, I Missed The Last Train And Stayed At The House Of A Female Colleague. .. .. "If You Don'T Have The Last Train, Stay At My House." Miu Shiramine

  • shiramine miublowjobslutIPXidea pocketkahori maedanodishIPX-683IPX683ipx00683
    • 2021-07-10
    127 min

    KYMI-013 Race Queen Slut

  • hamazaki mao suzuki mayuslutKYMImiluaida yumenoKYMI-013KYMI013kymi00013
    • 2021-08-07
    160 min

    XRLE-014 Developed Obscene Married Woman Who Feels In Anal ● Ko Mayu (Pseudonym) 28 Years Old

  • amateuranalcreampieXRLEk m producesugino kireal real worksXRLE-014XRLE014xrle00014
    • 2021-08-20
    240 min

    REXD-379 Sanctions On A Bossy Woman My Cock! "Oh ... It Works So Well ..."

  • amateurcreampieREXDreddogroupREXD-379REXD379rexd00379
    • 2021-08-20
    240 min

    REXD-377 A Trap Charged In Protein! Let'S Finish The Female Body Modification Plan With This!

  • amateurcreampieREXDreddogroupREXD-377REXD377rexd00377
    • 2021-08-21
    148 min

    APKH-184 Beautiful Girl And Seeding Love Hotel It Seems That Pubic Hair Is Unpleasant Though It Has A Cute Face! Individual Shooting Gonzo That Recorded An Immoral Relationship With An Older Favorite Girl Student Who Pleads For Vaginal Cum Shot. Taka

  • takayama tincreampieschoolgirlAPKHaurora project annexhAPKH-184APKH184apkh00184
    • 2021-08-26
    227 min

    SW-794 "Take A Bath Together!" Itoko'S Older Sister Who Treats Me As A Kid Suddenly Mixed Bathing With A Defenseless Boyfriend! I Secretly Grasped Ji Po Who Reacted Immediately And Was Washed With Milk And Rolled Up Secretly To My Family!

  • amateurbig titsSWswitchyocchanswitch hibinoSW-794SW7941sw00794
    • 2021-10-25
    104 min

    THNIB-080 Julina / Shuri Kitagawa

  • amateurbig titsbeautiful girlTHNIBcraneTHNIB-080THNIB080h-706thnib00080
    • 2021-10-09
    121 min

    MOPP-044 "Your Anal, I'Ll Make You Ikase" Ryomi Honoka, A Small Devil Slut'S Anal Pleasure Blame

  • suzumi honokaanalslutMOPPm o paradisemo platinumMOPP-044MOPP044mopp00044
    • 2021-10-22
    190 min

    SSIS-225 * No Script For The First Time In The Entertainment Life! !! Gonzo! No Makeup! Anything Ants! [Gravure] Miu Nakamura'S Lewd Nature Bare Sex! !! A Super Rare Eros 200% Video That Is Too Raw And Spoiled On A Hot Spring Trip Alone With A Apt

  • miu nakamurasingle workSSISs1 no 1 stylezack araiSSIS-225SSIS225ssis00225
    • 2021-10-27
    109 min

    RDVHJ-139 Amateur! !! Mother-Daughter Nampa Creampie! !! Vol 21

  • amateurcreampiebig titsRDVHJgurafiteijapanfeaesutoRDVHJ-139RDVHJ13948rdvhj00139
    • 2021-10-29
    120 min

    SHKD-971 A Married Woman Who Continued To Be Violated By Her Ex-Boss Who Hated Her And Woke Up To A Masochist Unfortunately. Kato Tsubaki

  • kato camellia kaoru natsukisingle workSHKDattackerstakasugi ryoushi yoru akuSHKD-971SHKD971shkd00971
    • 2021-10-29
    160 min

    CAWD-302 Dream Big Cock Gangbang Super Continuous Piston Special Natsu Hinata

  • natsu hinatasquirtingbeautiful girlCAWDkawaiikannana dainanaCAWD-302CAWD302cawd00302
    • 2021-03-11
    120 min

    FSDSS-189 Necho Necho Serious Juice Dripping Gravure Idol Shy Runaway Piston Cowgirl Kamiki Sara

  • sara kamikibig titssingle workFSDSSfalenokaorufaleno starFSDSS-189FSDSS1891fsdss00189
    • 2021-11-05
    130 min

    NGOD-159 Wife'S Salary Details Shameful Special Allowance Miho Tono

  • miho tsunobig titssingle workNGODjet eizougroupNGOD-159NGOD159ngod00159
    • 2021-11-11
    124 min

    SPRD-1478 Tabiji Mother And Child Traveling Yuri Tadokoro

  • yuri tadokoromature womanmomSPRDtakara eizoumishima rokusaburoaleddinSPRD-1478SPRD147818sprd01478
    • 2021-11-20
    131 min

    HOMA-111 Childhood Friend (Both Feelings) Who Reunited For The First Time In 10 Years, Pure Love Sex Ena Satsuki Who Has Repeated Physical Relationships Without Saying That They Like Each Other

  • ena satsukibeautiful girlsingle workHOMAh m p doramakc takedaHOMA-111HOMA111homa00111
    • 2021-12-11
    121 min

    KAGP-206 Onasapo! !! Girls ○ Raw Clothes Naked And Provocative Dance

  • horikita wan yuna kitanoKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-206KAGP206kagp00206
    • 2021-12-11
    135 min

    DVAJ-549 Ptom Sex Sato Who Blows White Bubbling Love Juice Covered Ji ○ Port At The Stakeout Piston Woman On Top Posture And Welcomes It To Ma ○ Ko Again

  • is it sato momoka katocreampieblowjobDVAJalice japanakai suiseiDVAJ-549DVAJ549dvaj00549
    • 2021-12-17
    150 min

    PPPD-991 Big Tits Juniors Who Missed The Last Train And Came To Stay From Friday Night To Monday Morning Pursued Infinite Pinch Shooting With 0 Confirmed Sperm Remaining! Suwon Miso Koume Ena

  • ena koume suwon misobig titsslutPPPDoppaiPPPD-991PPPD991pppd00991
    • 2021-12-23
    130 min

    KIRE-064 Former Local Announcer With Extraordinary Sex Talent And Intelligence 2021 Last Talent 28 Years Old Yui Kato AV DEBUT

  • amateursoloworkKIREsod createmonrei kirei sodKIRE-064KIRE064
    • 2022-01-14
    180 min

    MEYD-736 Yukari'S First Raw Vaginal Cum Shot With A Man Other Than A Married Woman Living In Chofu 6-Chome

  • amateurcreampieMEYDtameike gorohiromichi hoseMEYD-736MEYD736meyd00736
    • 2022-01-13
    201 min

    SW-821 My Sister'S H Sex Education I Was Taught A Lot By A Plump Woman'S Kara Davin Erection Ji Po Who Became An Adult!

  • amateurbig titssisterSWswitchyocchanswitch switchSW-821SW8211sw00821
    • 2022-01-22
    243 min

    NASH-635 Really Naughty Story 29

  • ayako inoue chiharu asomature womanNASHnadeshikoNASH-635NASH635nash00635
    • 2022-01-22
    132 min

    CEAD-388 Colossal Tits Plump Body Av Debut Shibata Amika

  • shibata amikabig titsmature womanCEADceleb no tomoCEAD-388CEAD388cead00388
    • 2022-01-28
    170 min

    JUFE-366 Reverse 3P Seeding Sexual Intercourse With A Busty Sister At A Minshuku Who Was Hungry For Fertilization Insects Miu Kitano Mina Arioka

  • mina kitano arioka miucreampiebig titsJUFEfitchJUFE-366JUFE366jufe00366
    • 2022-01-28
    125 min

    ABW-193 Natural Ingredient-derived Kobato Wheat Juice 120% 76 Amazing 4 Productions That Forget Reason And Devour Pleasure

  • kobato mugisquirtingsoloworkABWprestigecharlie nakataabsolutely wonderfulABW-193ABW193
    • 2022-02-01
    118 min

    PC-021 Scat Masturbation Anal Masturbation That Rakes Out Poop Every Time You Pull Your Finger

  • amateuranalPCplanet plusamateur panicPC-021PC021h-189pc00021
    • 2022-02-04
    240 min

    TYSF-001 Natural Mizuki Kuruki Rei Who Won'T Return Until A W Bitch Who Loves Super Fuck Gets Into Your House And Puts Out Semen

  • natural mizuki satoshi kurukislutTYSFroyalkawajirihhh groupTYSF-001TYSF001tysf00001
    • 2022-02-04
    140 min

    JUL-860 During My Wife'S Pregnancy, Even Masturbation Was Forbidden, And I Have Seeded Sex With My Mother-In-Law Kana Who Came To Tokyo Many Times... Kana Mito

  • kana mitocreampiemature womanJULmadonnarokusaburo mishimaJUL-860JUL860jul00860
    • 2022-02-05
    240 min

    SCR-290 Mud ● Female Vaginal Cum Shot ● Pu Leaked Video 4 Hours

  • amateurcreampiebig titsSCRglay zs crimeSCR-290SCR29012scr00290
    • 2012-10-01
    60 min

    GS-422 Underage (2309) Shoplifting Girl 32

  • amateurschoolgirlamateurGSsosoru x garconred ballGS-422GS422h-101gs00422
    • 2022-02-10
    108 min

    NEO-383 I Want To Fire On The Beautiful Hair Of Girls In Uniform 3

  • miyazaki rin riho takahashiuniformbeautiful girlNEOradixshio sakurabaneo radixNEO-383NEO383433neo00383
    • 2022-02-18
    130 min

    ROYD-083 Homely And Naive Beautiful Sister-In-Law Is Devoted Anywhere In The House ● Transform Into A Pogatsuki Woman Www Mochi Ron Vaginal Cum Shot Ok! Natsuki Maron

  • marin natsukicreampiesisterROYDroyalmorikihhh groupROYD-083ROYD083royd00083
    • 2022-02-25
    130 min

    SHKD-988 Career Woman'S Wet Pantyhose Sasahara Yuri

  • yuri sasaharasingle workdramaSHKDattackerstkuo otanisharkSHKD-988SHKD988shkd00988
    • 2022-02-25
    150 min

    SHKD-989 Aoi Nakagusuku, A Serious Female Student Who Has Been Fucked

  • nakagusukuuniformsingle workSHKDattackersjo styleshi yoru akuSHKD-989SHKD989shkd00989
    • 2022-01-27
    136 min

    KNAM-050 Complete Raw STYLE @ Minami Momo Even Though She Has A Neat Face, She Is A Big Pie J ● And Enko Wait A Minute! Now, If The Big Pie Is Emphasized, You Will Want To Massage It Before Going To The Hotel!

  • minami momocreampiebig titsKNAMfirst starkannama styleKNAM-050KNAM050
    • 2010-12-10
    117 min

    HSM-038 3Am Snack Mom Hunter 2

  • amateurbig titsamateurHSMhime styleHSM-038HSM03859hsm00038
    • 2022-03-12
    115 min

    BJD-046 Mature Full Moon Nasu Oami Onsen'S Journey Rei Yuki

  • yui yuuki rei misaki rei misakicreampiemature womanBJDrubysaburo waremebojyoBJD-046BJD046bjd00046
    • 2022-04-07

    FSDSS-397 Studio FALENO Never Weaning ... My Sister's Boobs That Raised Me Healthy. Kaname Momojiri

  • kaname momojiribig titsuniformFSDSSfaleno2 consecutive rate 25FSDSS-397FSDSS3971fsdss397
    • 2022-03-16
    240 min

    MXSPS-681 Welcome To The Finest Paradise! Super Luxury Soapland Without Loss 4 Hours

  • yume kana yokoyama miyukiMXSPSmaxingMXSPS-681MXSPS681h-068mxsps681
    • 2022-03-23

    MFC-185

  • amateurMFCmoon forceMFC-185MFC185
    • 2022-02-02

    POW-068

  • amateurbig titsamateurPOWamateur hey hey powerpow068pow 068POW-068POW068pow068



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free