h_1660bare00003




PPPDDASDSSNIDASDAUKSHMNATIDSPRDCAWDMVSDFSDSSSQTEEBODNNPJAPODKSBJMARAIPXHNDJUFE

2021-02-07
101 min

VENX-003 Incest Bikini Mama I Can'T Give Up This Year'S Trip To Hawaii ... Mako Oda

  • oda makocreampiebig titsVENXvenuspeterfakecest winntersVENX-003VENX003venx00003
    • 2021-02-18
    220 min

    HUNTA-950 I Was Desperately Giving A Blow Job To My Father Who Was Tired And Fell Asleep Earlier. My Father Remarried ...

  • amateurcreampieblowjobHUNTAhunterkoichi davidsonhhh groupHUNTA-950HUNTA950hunta00950
    • 2021-03-13
    120 min

    MEYD-658 Tameike Goro 15Th Anniversary Year Collaboration 2Nd The Company That Was Adopted By Applying For The Part Recruitment Called "Video Related" Is An Av Maker. Av Debut As A Married Woman Actress Even Though I Started Working As Ad Saki Okuda

  • saki okudabig titssquirtingMEYDtameike gorohirokoji osakiMEYD-658MEYD658meyd00658
    • 2021-03-15
    197 min

    PYM-369 Desire Fully Open Ol Shivering Iki Sleep Cafe Masturbation

  • amateuramateurPYMprimoPYM-369PYM369h-283pym00369
    • 2021-03-15
    121 min

    ZEX-402 "I Want To Be My Father-In-Law'S Woman ..." Ayano Kato, A Widow'S Love That Became A Real Reality When I Imagined Something Unscrupulous

  • ayano katobig titssingle workZEXpeters maxZEX-402ZEX402h-720zex00402
    • 2021-03-18
    120 min

    PPPD-910 When I Missed The Last Train With A Company Drink And Stayed At The House Of A Boss With Huge Breasts Who Got Drunk ... I Was Pushed Down By "Rubbing My Boobs !!"

  • hitomicreampiebig titsPPPDoppaiPPPD-910PPPD910pppd00910
    • 2021-03-25
    165 min

    SPRD-1389 Saffle At That Time ... Is My Friend'S Mother Ayaka Makimura

  • ayaka makimurabig titsmature womanSPRDtakara eizokon oriharualeddinSPRD-1389SPRD138918sprd01389
    • 2021-04-02
    320 min

    HUNTA-986 I'M Shy And Have Started Dating My Super Cute Sister-In-Law ... 3

  • amateurcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-986HUNTA986hunta00986
    • 2021-04-10
    124 min

    MOPT-005 The Best M Sexual Feeling Customs That Keeps Being Stopped By Irritating M Men'S Ejaculation

  • yui nagaseanalslutMOPTm o paradisemo tightMOPT-005MOPT005mopt00005
    • 2021-04-17
    160 min

    JUL-549 I Decided To Go On A Business Trip For 2 Nights And 3 Days, Leaving My Father Who Loves Women And My Wife Who Is Vulnerable To Pushing. Karen Sasahara

  • karen sasaharamature womansingle workJULmadonnamametaro mamezawaJUL-549JUL549jul00549
    • 2021-04-18
    120 min

    NEWM-002 True / Abnormal Sexual Intercourse Fifty Mother And Child Part 2 Sayako Sanada

  • sanada sanakomature womanmomNEWMglobal media entertainmentyayoi nakanonewmomNEWM-002NEWM002newm00002
    • 2021-04-23
    120 min

    JJDA-017 Kayo Iwasawa, A Gentle And Gentle Afternoon Busty Housewife Who Gave You An Apprentice In The Interior Industry

  • kayo iwasawacreampiebig titsJJDAmature woman college real mature womanmanji groupJJDA-017JJDA017jjda00017
    • 2021-05-29
    123 min

    RPIN-052 A Beautiful Designer Who Loves Ji ● Po A Bright And Vulgar Sister Gets Drunk And 3P, Irama, Gero, Strangling Big Cock Thrusting Acme!

  • amateurRPINlycopene mousouzokukakeru ozoraRPIN-052RPIN052rpin00052
    • 2021-06-11
    120 min

    EBOD-834 Dengeki Revival Ultimate Slim Big Breasts Body Miyuki Arisaka Is The Limit

  • arisaka miyukicreampiebig titsEBODe bodymichiru arashiyamaEBOD-834EBOD834ebod00834
    • 2021-07-02
    120 min

    BBAN-331 No.1 Repeat Rate! Cuckold Rate No.1! A Married Woman Who Has Been Addicted To Lesbian Sex With Big Tits Deriheru Nene Tanaka Ayano Kato

  • nene tanaka ayano katobig titslesbianBBANbibianBBAN-331BBAN331bban00331
    • 2021-07-02
    170 min

    SSIS-104 * No Script At All! !! Gonzo! No Makeup! Anything Ants! Saki Okuda'S Lewd Nature Bare Sex! !! 200% Video Of Super Rare Eros That Is Too Raw And Spoiled On A Hot Spring Trip Alone With A Apt

  • saki okudabig titssingle workSSISs1 no 1 stylearashiyama michiruSSIS-104SSIS104ssis00104
    • 2021-07-09
    120 min

    MIAA-466 Karen Kaede Decided To Practice Sex And Vaginal Cum Shot With Her Childhood Friend Because She Was Able To Do It For The First Time

  • karen kaedecreampieschoolgirlMIAAmoodyzminna no kikatanMIAA-466MIAA466miaa00466
    • 2021-07-15
    131 min

    TIKB-116 Onikawa Choroman Paco Paco Friend Hanatan White Peach Hana

  • white peachcreampiebeautiful girlTIKBtikitiki.comerTIKB-116TIKB116tikb00116
    • 2021-07-17
    240 min

    REXD-372 E! ?? It Really Took Me ... Event ● Skill Circle "It'S Okay To Touch It A Little"

  • amateurcreampiebig titsREXDredmanji groupREXD-372REXD372rexd00372
    • 2021-08-20
    240 min

    REXD-377 A Trap Charged In Protein! Let'S Finish The Female Body Modification Plan With This!

  • amateurcreampieREXDreddogroupREXD-377REXD377rexd00377
    • 2021-08-21
    240 min

    MDBK-194 Superb Creampie Dense Sex 50 People 4 Hours

  • natsuho imai yano tsubasacreampiebig titsMDBKk m producek taroubazookaMDBK-194MDBK194mdbk00194
    • 2021-09-11
    136 min

    APKH-186 Sister System! A Beautiful Busty Female Student Takes A Rich Gonzo With A Perverted Dad And A Love Hotel, Shakes A Huge Breast And Rides Radically! A Masochist Girl Who Spree In The Vagina! Hiyori Aozora

  • hiyori aozoracreampiebig titsAPKHaurora project annexhAPKH-186APKH186apkh00186
    • 2021-09-25
    120 min

    JSOP-006 New And Beautiful Mature Woman Bathhouse Rich Soggy Luxury Soap Kasumi Ikeya

  • kazumi ikeyamature womansingle workJSOPglobal media entertainmentnakano yayoijukujo soupJSOP-006JSOP006jsop00006
    • 2021-10-09
    120 min

    BAAM-004 Ruru Arisu, A Petite Beautiful Girl Gal Who Connects Gal Beads.

  • amateuramateurBAAMbarutanyurukoamazonessBAAM-004BAAM004baam00004
    • 2021-10-29
    120 min

    CAWD-300 Obedient Tadapaco Niece Moko Sakura Who Listens To Anything I Say

  • sakura mokocreampiesingle workCAWDkawaiikimura hiroyukiCAWD-300CAWD300cawd00300
    • 2021-11-11
    174 min

    NHDTB-598 Slut ● Beautiful Legs Woman Who Is Fingered In Pantyhose By A Teacher And Blows A Lively Tide So That Wet Stains Can Be Made 4

  • amateursquirtingNHDTBnatural highkansukeNHDTB-598NHDTB5981nhdtb00598
    • 2021-11-19
    110 min

    HUNBL-069 "Don'T Touch My Daughter!" "Then ... Just Give It To My Daughter!"

  • amateurcreampieschoolgirlHUNBLhuntergeminihhh groupHUNBL-069HUNBL069hunbl00069
    • 2021-12-09
    183 min

    NHDTB-607 Girls ○ Students Who Continued To Be Squid Who Was Sucked By A Sensitive Big Breasts Who Became Aphrodisiac By Unequaled Ji-San At A Manipulative Clinic

  • amateurbig titsschoolgirlNHDTBnatural highvanilla sakuraiNHDTB-607NHDTB6071nhdtb00607
    • 2021-12-14
    127 min

    KTRA-356E Sex Education Nakamura Rio Out Of Daddy Torio'S Shaved Pussy

  • rio nakamuracreampieblowjobKTRAke toraibuk tribeKTRA-356eKTRA356eh-094ktra00356e
    • 2021-12-20
    108 min

    VNDS-5218 Until I Die... I Can'T Tell My Husband... My 60Th Birthday Mother Who Was Done By A Middle-Aged Son Emi Toda

  • emi todacreampiemomVNDSstar paradisenext toilet r eVNDS-5218VNDS5218h-254vnds05218
    • 2021-12-24
    115 min

    GHNU-57 Married Woman Former Super Heroine M Training Marshall Pink Edition Tsukasa Nagano

  • nagano tsukasamarried womansoloworkGHNUgigashiki masayoshiGHNU-57GHNU57
    • 2021-12-28
    480 min

    KATU-093 Yuri Honma Ultra BEST 8 Hours

  • honma yuribig titssoloworkKATUkatsuo bussan mousouzokumaglowKATU-093KATU093
    • 2021-12-31
    140 min

    BF-653 I Could Not Stand My Student'S Braless Boobs And I Had Mess Sex At A Love Hotel. Misono Mizuhara

  • suwon misobig titsschoolgirlBFbefreeroku yonBF-653BF653bf00653
    • 2022-01-22
    119 min

    LUNS-092 Immoral Copulation Of The 60Th Birthday 15

  • amateurcreampiemature womanLUNSluna shunkoshaLUNS-092LUNS092luns00092
    • 2022-02-05
    240 min

    CADV-840 My Longing Girlfriend, Misono Waka

  • misono wakacreampiebig titsCADVcrystal eizocrystal exCADV-840CADV840cadv00840
    • 2022-02-11
    140 min

    JUFE-370 Bristle Sisters Who Are Soaked In Sex While Seeing Each Other'S Iki Faces Are Conceived Training Tsukino Kasumi Hosho Mei

  • kasumi tsukino mei hoshocreampiesisterJUFEfitchJUFE-370JUFE370jufe00370
    • 2022-02-18
    180 min

    HMN-121 Begging De M Female College Student Wanting To Become More Naughty And Comfortable, First Raw Vaginal Cum Shot Natsumi Yurika

  • natsumi yurikacreampiebeautiful girlHMNhon nakausa pyonHMN-121HMN121hmn00121
    • 2022-02-03

    OPCYN-247

  • amateurOPCYNtitty girlopcyn247opcyn 247OPCYN-247OPCYN247
    • 2022-04-01
    237 min

    HODV-21667 After All I Like Amateurs!! 12 People 4 Hours

  • amateurcreampiebig titsHODVh m pHODV-21667HODV216675642hodv21667
    • 2022-04-01
    160 min

    WAAA-158 The Condom Is Torn And It'S A Bareback! Vaginal Cum Shot Many Times With A Super Accelerating Piston! Anna

  • annacreampiebig titsWAAAwanz factorywanzWAAA-158WAAA158waaa00158
    • 2022-04-02
    301 min

    EK-011 Monthly Married Woman Senka Erokari No.11

  • amateuramateurmature womanEKplumkuzu father akiraEK-011EK011h-113ek00011
    • 2022-04-20
    121 min

    SPZ-1126 Climax Agony Massage! A Beautiful Ass Esthetic Salon Where Celebrity Wives Attend

  • amateurSPZstar paradisestar paradiesSPZ-1126SPZ1126h-254spz01126
    • 2022-04-20
    121 min

    NACR-532 The Beautiful Wife Next Door Mud ● I Made A Mistake In The Room And “I'M Home!” Nagata Riu

  • riame nagatacreampiebig titsNACRplanet plusdirector oNACR-532NACR532h-237nacr00532
    • 2022-04-23
    242 min

    MCSR-481 Real Record Mature Couple & Affair Couple Swapping Voyeur 20 Pairs 4 Hours 2

  • amateuramateurmature womanMCSRbig morkalsaburo kamegashimamascottMCSR-481MCSR48157mcsr00481
    • 2022-04-29
    120 min

    WAAA-161 Little Devil Provocation Mesuiki Slutty Girl Hinako Mori Who Plays Anal While Teasing With Her Eyes From Above

  • hinako moriblowjobslutWAAAwanz factoryWAAA-161WAAA161waaa00161
    • 2022-05-06
    230 min

    HUNTB-264 If You Lick Your Yariman Classmate'S Anal Enough To Swell, Continuous Convulsions Will Be Alive! A Yariman Classmate Who Makes A Fool Of Me As A Virgin Says “If You'Re Frustrated, Try Inserting It”...

  • amateuranalcreampieHUNTBhunterkonnyaku kannohhh groupHUNTB-264HUNTB264huntb00264
    • 2022-05-06
    230 min

    TSP-454 Limit Max! My Meat Stick With An Erection! Mud Being Assisted By The Homeless ● Woman “Come On... Don'T Enter My House... Nichaa”

  • amateurcreampieblowjobTSPtoukyou supesharugroupTSP-454TSP454tsp00454
    • 2022-05-21
    118 min

    AGMX-124 Show Off Mako With M-Shaped Legs Joi

  • ichijo mio nanako miyamuraslutAGMXsex agentyuuki mogeraAGMX-124AGMX124agmx00124



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free