h_1450osst00030




JUFESTARSAVSAWAAAKSBJMIDVSHKDFSDSSDTTMIAAMEYDNATRMARANACRMILKSSISAUKGONEZABWVENX

2021-02-28
129 min

EMBZ-222 A Housewife Who Fell Into The Trap Of A Dark Massage Salon Was Filled With Sleeping Pills And Was Cummed Inside, And After Awakening, She Was Treated With Aphrodisiac Oil And De M Wheel ● The Womb Of A Married Woman Who Goes Crazy With An Ma

  • anne mashirocreampiesingle workEMBZjukujojuku emmanuellejukujo jukuEMBZ-222EMBZ222embz00222
    • 2021-03-06
    120 min

    JUL-493 Pillow Sales Ntr ~ Physical Service Of Dedicated Wife Supporting My Beloved Husband ~ Mayuka Kitagawa

  • mayuka kitagawabig titsmature womanJULmadonnajotaro tomiJUL-493JUL493jul00493
    • 2021-04-02
    190 min

    HUNTA-983 A Female Manager Who Gets Sick By Drinking A Room Without A Squirrel During A Club Activity Training Camp Is Turned Into A Meat Urinal Instead Of A Male Member Until She Gets Tired Of The Training Camp For 1 Night And 2 Days.

  • amateurcreampieHUNTAhunterkawajirihhh groupHUNTA-983HUNTA983hunta00983
    • 2021-04-15
    85 min

    HTHD-185 Friend'S Mother-Final Chapter-Mako Oda

  • oda makocreampiemature womanHTHDcenter villagedaichi minamihona zonoHTHD-185HTHD185h-086hthd00185
    • 2021-04-18
    119 min

    QRDA-126 First Transvestite Pleasure Anagazum Experience Rumi Is Squid Until She Becomes A Woman And Goes Crazy

  • amateuranalQRDAqueen roadQRDA-126QRDA126qrda00126
    • 2021-04-20
    240 min

    MGDN-151 9 People 4 Hours To Persuade The Cleaning Staff'S Aunt To Sex

  • amateuruniformmature womanMGDNstar paradisemegadonMGDN-151MGDN151h-254mgdn00151
    • 2021-04-20
    139 min

    VNDS-5210 Superb Mature Woman Hitomi Enjou Bombshell Mature Body

  • hitomi enjocreampiebig titsVNDSstar paradisenext toilet r eVNDS-5210VNDS5210h-254vnds05210
    • 2021-04-23
    150 min

    CLUB-637 A Power Harassment Female Boss Forced Me To Have A Drinking Party, So I Made The Boss Who Was Weakened By Mud ● Squid To Death With A Continuous Attack Piston And Even Made Vaginal Cum Shot. Vol.2

  • amateurcreampiebig titsCLUBhentai shinshi clubCLUB-637CLUB637club00637
    • 2021-05-07
    150 min

    MIFD-157 Rookie Yumeou Virgin Idol Avdebut! !! Himari Ayase

  • himari ayasesingle workMIFDmoodyzusa pyonmoodyz freshMIFD-157MIFD157mifd00157
    • 2021-05-08
    210 min

    BAZX-288 Obscene Completely Subjective Sexual Intercourse With A Longing Colleague Vol.002

  • amateurcreampieuniformBAZXbazookatodoBAZX-288BAZX288bazx00288
    • 2021-05-08
    130 min

    AVSA-166 Super Fisheye Fetishism Powerful Excitement Honey Photo Libido Bitch Wife Muchimuchi Fleshy Erotic Body Yuuri Oshikawa

  • yuri sugawabig titssingle workAVSAavs collector sbuddha davscollector sAVSA-166AVSA166avsa00166
    • 2021-05-21
    120 min

    CAWD-213 M Woman Specialized Deriheru A Younger Female Boss Who Hates Looking Down When You Call Me ... Completely Obeyed And Speared Until An Antibody Was Made Reversal Of Position ● Mayuki Ito

  • maiyuki itocreampiedeepthroatCAWDkawaiizaku araiCAWD-213CAWD213cawd00213
    • 2021-05-22
    239 min

    MCSR-439 Mothers Who Are Squid By Their Son'S Big Cock 10 People 4 Hours

  • amateurbig titsmature womanMCSRbig morkalguo masumascottMCSR-439MCSR43957mcsr00439
    • 2021-06-12
    111 min

    MOPT-008 Long-Legged Sister'S M Man Bullying Pantyhose, Jeans And Knee High Boots Shoko Otani

  • shoko otanianalslutMOPTm o paradisemo tightMOPT-008MOPT008mopt00008
    • 2021-06-16
    240 min

    HUNTB-033 "Do You Want To Get Used To It By Touching It?" If I Was Training To Overcome An Erection With A Girl (Tutor, Sister-In-Law, Childhood Friend ...) Who Was Worried That I Couldn'T Live Normally Because I Had An Erection Due To A Trivial Matt

  • amateurcreampieblowjobHUNTBhuntermorikihhh groupHUNTB-033HUNTB033huntb00033
    • 2021-06-20
    122 min

    NDWQ-011 Throat Demon Training Female Body Fluid Reverse Injection Makoto Kawagoe

  • makoto kawagoecreampiesquirtingNDWQtoyohikozarakiseiunkai ekusutorimuNDWQ-011NDWQ011ndwq00011
    • 2021-06-25
    102 min

    YSN-551 My Horny Father-In-Law And My Horny Daily Life Yuri Honma

  • reallycreampiebig titsYSNnonYSN-551YSN551h-127ysn00551
    • 2021-07-06
    134 min

    STARS-392 Yuna Ogura, A Popular Hairdresser, Is Actually A Ridiculous Kisser Who Seduces Customers.

  • yuna oguracreampieslutSTARSsod createchinpo dazaisod starSTARS-392STARS3921stars00392
    • 2021-07-14
    120 min

    TPPN-200 Iron Plate! First Advent! Rei Futami Please Be More Disciplined, Both Physically And Mentally ... Aiiku Story That Falls Into The Finest Pleasures As You Say The Limit Of Shame!

  • rei futamicreampiebeautiful girlTPPNteppanTPPN-200TPPN200tppn00200
    • 2021-08-12
    107 min

    ZEAA-64 Blonde Half Wife's Domaso Fuck Karina Nishida

  • nishita karinacreampiemarried womanZEAAcenter villagemurakigoku centervillageZEAA-64ZEAA64
    • 2021-08-14
    130 min

    ONSG-040 Big Breasts Deriheru Serina Riku

  • serina rikucreampiebig titsONSGgeinko pore shongain corporationONSG-040ONSG040onsg00040
    • 2021-08-20
    130 min

    PXH-033 Obo Girl # 010 # Kaede (24) # Super Kitsman # No Complaints Beautiful Legs # Facial Deviation Value Higher # Slender Beautiful Body # Tatsumi Cafe Clerk # Systemic Ecstasy

  • amateuramateurPXHprestigeprestige hmjmPXH-033PXH033
    • 2021-08-27
    130 min

    DTT-084 I Love The Smell Of Semen And Am I A Metamorphosis Like This ...? Married Woman Kurusu Who Can Be Painted Cloudy Is Her 33-year-old AV Debut! !!

  • amateurmarried womanDTTprestigetsuruhashidaitetsuDTT-084DTT084
    • 2021-09-17
    120 min

    MUDR-162 A Story That Became A Harem When I Picked Up A Runaway Gal ~ The Beginning Of Cohabitation Life ~ A Dream Reverse 3P Life Surrounded By Pure White Gals And Ikeike Black Gals Hana Himari Kinoshita

  • himesaki hana himari kinoshita himari hanazawauniformMUDRmukuMUDR-162MUDR162mudr00162
    • 2021-09-29
    120 min

    T28-605 Tanned Niece Sisters Natsu Tojo Natural Mizuki

  • natsu tojo natural mizukibeautiful girlT28tmaT28-605T2860555t2800605
    • 2021-10-16
    119 min

    USBA-036 Natsu Tojo, A Middle-Aged Teacher Trained By A Small Devil Girl

  • natsu tojoschoolgirlbeautiful girlUSBAavsusubashi suiavscollectorsUSBA-036USBA036usba00036
    • 2021-10-16
    117 min

    DDK-206 Mebuta Hut Female Livestock Plant Otsu Alice

  • otsu alicecreampiecosplayDDKdogmano maru kimDDK-206DDK206ddk00206
    • 2021-10-22
    180 min

    MISM-217 First Throat Penetration

  • amateurbeautiful girldeepthroatMISMemumusume labkanou hanaMISM-217MISM217mism00217
    • 2021-11-11
    121 min

    GUN-865 Overdo It! Pee Sister Mao Watanabe

  • mao watanabesingle workGUNradixsakuraba kyuu kokoro otokobatsugunGUN-865GUN865433gun00865
    • 2021-11-25
    200 min

    DANDY-789 It Was A Spear Man Who Asked Many Times When I Invited A Men'S Esthetician Who Gave Me A Secret Service To A Hot Spring Trip

  • amateurcreampiebig titsDANDYdandyozu kikujirouDANDY-789DANDY7891dandy00789
    • 2021-12-03
    135 min

    JJCC-013 Married Woman'S Overflowing Honey Rieko

  • amateurcreampiemature womanJJCCjuku onna japan emmanuellejuku onna japanJJCC-013JJCC013jjcc00013
    • 2010-01-12
    122 min

    SS-044 Amateur Sailor Out Creampie 044

  • amateurcreampieschoolgirlSSdahliayaru yoshi 3SS-044SS044h-113ss00044
    • 2021-12-11
    63 min

    BAB-043 Immediately Saddle Banned Daughter Anywhere Kaho Imai

  • natsuho imaibig titssingle workBABbabylon mousozokuBAB-043BAB043bab00043
    • 2021-12-23
    120 min

    ARSO-21153 Mai Wife ~Celebrity Club~ 153

  • sugimura mami akagi rikoARSOaroundkiiroi hyouARSO-21153ARSO21153h-1378arso21153
    • 2021-12-23
    323 min

    YARI-004 It'S All Of A Sudden, But Can I Have A Look At My Dick? 3

  • amateurcreampiesquirtingYARIyariman bitchesYARI-004YARI0041yari00004
    • 2022-01-05
    241 min

    NACX-093 12 Shaved Mature Women Best Vol.03

  • arisa hanyu arisu hanyu maria nagaibig titsmature womanNACXplanet plusshichi ku ryuuNACX-093NACX093h-237nacx00093
    • 2022-01-07
    150 min

    JUL-823 Obscene Middle-Aged Copulation Kinoshita Rinko Seen In A 69-69 - Emotional Affair On A Summer Day When Sweat Is Dripping

  • kinoshita rinkobig titsmature womanJULmadonnahiroyuki kimuraJUL-823JUL823jul00823
    • 2022-01-14
    123 min

    TPPN-215 J Cup Huge Breasts “Tsujii Honoka” Is Sweaty And Filthy By Entangling The 9Cm Snake Long Tongue Of The Overwhelming Genius That God Gave Into A Meat Stick! Vaginal Cum Shot Sex

  • tsujii honokabig titsblowjobTPPNteppanTPPN-215TPPN215tppn00215
    • 2022-01-15
    109 min

    OIGS-043 Rope Drunk Married Woman The Forbidden Rope Training Of A Married Woman And An Ex-Lover Mako Oda

  • oda makobig titsbdsmOIGSavs collector susubashisuiavscollector sOIGS-043OIGS043oigs00043
    • 2022-01-16
    120 min

    MXGS-1220 G Cup Beauty Busty Beauty Close Contact Love SEX Asakura Here

  • asakura kokonacreampiebig titsMXGSmaxingMXGS-1220MXGS1220
    • 2022-01-22
    150 min

    SCPX-440 My Wife Has Too Many Erotic Breasts, So I Won'T Be Taken Down Lol

  • amateurcreampiebig titsSCPXscoopmousouzokuSCPX-440SCPX440scpx00440
    • 2022-01-28
    120 min

    CAWD-329 Revengers Ring That Chops The Pride Of A High-Rook Woman Who Treats Us As Garbage With A Lump Of Self-Revealing Desire To Wood Edge Dust ● Ito Maiyuki

  • maiyuki itocreampiesingle workCAWDkawaiitrendy yamaguchiCAWD-329CAWD329cawd00329
    • 2022-01-29
    130 min

    OVG-191 Vaginal Cum Shot To Miss Deriheru Who Is Absolutely Prohibited! 2 If You Are Rubbed By Ma ○ Ko With Oil Intercrural Sex, It'S Too Comfortable And I Involuntarily Inserted Raw! Sensitive Busty Lady Who Gets Vaginal Cum Shot While Hating No Goo

  • mina kitano ami yozoracreampiebig titsOVGglory questOVG-191OVG191ovg00191
    • 2022-02-18
    210 min

    HUNTB-213 “It Calms Down When I Touch My Chin...” My Older Sister, Who Calms Down When I Touch My Crotch From An Early Age, Touches Me That She Has Some Anxiety Even Now That She Is An Adult. I Refused...

  • amateurcreampieblowjobHUNTBhuntermorikihhh groupHUNTB-213HUNTB213huntb00213
    • 2022-02-18
    135 min

    BOKD-245 This Kawai Ko-Chan Actually Is Bullied And Gets A Full Erection, The Daughter Of A Bitch And Masochistic Man Takanashi Kanon

  • little bird play flower soundcreampiesingle workBOKDwe 039 re she malessuginokiBOKD-245BOKD245bokd00245
    • 2022-02-20
    120 min

    NACR-511 Aphrodisiac Suggestion A Beautiful Wife Manipulated By Her Husband'S Subordinates Yumika Saeki

  • yuka saekicreampiemature womanNACRplanet plusbito sakurananakuruNACR-511NACR511h-237nacr00511
    • 2022-02-20
    124 min

    HDKA-252 Naked Housewife Nagata Riru, Who Lives In Shinagawa Ward (30)

  • riame nagatacreampiebig titsHDKAplanet plusdirector orafu shukoHDKA-252HDKA252h-237hdka00252
    • 2022-02-19
    242 min

    NASH-652 A Grandmother Who Reclaimed The Pleasure Of The Cum That Was About To Be Forgotten By Her Grandson'S Big Dick Past Sixty Years 4

  • amateurcreampiemature womanNASHnadeshikojun nagasawaNASH-652NASH652nash00652



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free