h_1067bkkg00027




HDKAHUNTBJUFEPREDSSISMVSDMILKMIDEMARASANVEMAMEYDGVHMIDVLULUKSBJVENXNGODBLKCHRV

2021-06-20
128 min

APNS-246 I'M Screaming That I'M Being Circulated By My Vulgar Dads ... White Peach Hana

  • white peachcreampieschoolgirlAPNSaurora project annexyukihiro nasuaurora project anexAPNS-246APNS246apns00246
    • 2021-06-25
    160 min

    AOZ-302z Girls 〇 Raw Tailing Elevator Slut ● Obscene Video

  • fukada yuuri nagisa mitsukibeautiful girlAOZaozora softAOZ-302AOZ302
    • 2021-07-02
    170 min

    SSIS-104 * No Script At All! !! Gonzo! No Makeup! Anything Ants! Saki Okuda'S Lewd Nature Bare Sex! !! 200% Video Of Super Rare Eros That Is Too Raw And Spoiled On A Hot Spring Trip Alone With A Apt

  • saki okudabig titssingle workSSISs1 no 1 stylearashiyama michiruSSIS-104SSIS104ssis00104
    • 2021-07-14
    120 min

    MVSD-471 Remote Control Nts Indecent Pant Of My Beloved Wife Drowning In Another Stick Michiru Kujo

  • kujo michirucreampieblowjobMVSDm s video groupbungo maedaMVSD-471MVSD471mvsd00471
    • 2021-07-22
    170 min

    MIAA-474 Welcome To Reverse Bunny Soapland Creampie Black Gal! ~ Tameguchi'S Habit, But Estrus Dirty Little Kurojiri Usa-Chan Is Fully Seeded! ~ Remi

  • remicreampiebig titsMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-474MIAA474miaa00474
    • 2021-07-30
    140 min

    ISRD-003 Female Teacher In ... (Intimidation Suite Room) Miya Tanaka

  • miya tanakaanaldeepthroatISRDdream tickettakuanvivid dori muchikettoISRD-003ISRD00324isrd00003
    • 2021-08-06
    120 min

    SKSK-056 SUKUSUKU A Nursing Club Has Been Established At Our School Tsugumi Makoto

  • makoto tsugumiamateurSKSKprestigesukesukeSKSK-056SKSK056
    • 2021-08-06
    120 min

    ONEZ-299 Usually A Neat And Serious Married Woman Is Handsome And Pays Money At A Shared Room Hotel With A Big Cock Male Prostitute And Begs For Pregnancy Affair Sex Mari Kagami

  • kagami maricreampiesoloworkONEZprestigetodoonezONEZ-299ONEZ299
    • 2021-08-12
    120 min

    GUN-859 If You Stretch Your Legs, You Too Will Be Synchronized! I Can Only Love Foot Peen Anymore! Hamazaki Mao

  • hamazaki maosquirtingsingle workGUNradixmg yukkybatsugunGUN-859GUN859433gun00859
    • 2021-08-20
    240 min

    REXD-377 A Trap Charged In Protein! Let'S Finish The Female Body Modification Plan With This!

  • amateurcreampieREXDreddogroupREXD-377REXD377rexd00377
    • 2021-08-27
    118 min

    ISRD-004 Female Doctor In ... (Intimidation Suite Room) Nozomi Haneda

  • nozomi hanedamature womandeepthroatISRDdream tickettakuanvividISRD-004ISRD00424isrd00004
    • 2021-09-03
    280 min

    DVDMS-693 Hairy Oma Co ○ Sisters Who Love Cunnilingus! Raw Ma ○ Co Taste Sex With Two Perverted Hairy Sluts Who Want To Lick Man Until Incontinence

  • momose asuka mamiya nagicreampieslutDVDMSdeepsmotofuji peroflavorsDVDMS-693DVDMS693dvdms00693
    • 2021-09-17
    170 min

    JUFE-330 A Beautiful Married Woman'S Soggy Sweet Kiss And Luxury Lingerie Sex Akari Niimura, The Wife Of An Urban Living Uncle Who Seduces Me Who Raised In The Country

  • akari shinmuracreampiebig titsJUFEfitchJUFE-330JUFE330jufe00330
    • 2021-10-29
    120 min

    ADN-352 The Next Time I'Ll Meet Is One Week Later ... A Hot Spring Trip That Ejaculates With My Mistress Many Times In A Short Time Aya Hara Natsume

  • natsume saiharusingle workdramaADNattackersdoragon nishikawaotona no dramaADN-352ADN352adn00352
    • 2021-11-05
    140 min

    SSIS-235 Ultimate Pleasure And Massive Saliva Soup Wet Meat Jcup Body Aka Asuka

  • arisu akabig titssquirtingSSISs1 no 1 stylenabeSSIS-235SSIS235ssis00235
    • 2021-11-13
    156 min

    ONSG-044 Big Tits Delivery Health Yuria Yoshine

  • yoshine yuriacreampiebig titsONSGgeinko pore shongain corporationONSG-044ONSG044onsg00044
    • 2021-11-20
    157 min

    KATU-091 Big Breasts X Big Ass X Slut Dosukebe Wife Nampa Hamijiri Miniskirt Gal Is Super Spear Man!

  • amateurbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-091KATU091katu00091
    • 2021-11-25
    120 min

    DLDSS-036 I Don'T Want To Be Known Only To You ... I Sincerely Regret The Mistake Of Being Attacked By My Daughter'S Boyfriend By Force And Continuing An Unscrupulous Relationship. Rin Azuma

  • dongguancreampiedeepthroatDLDSSdahliasho saigoDLDSS-036DLDSS0361dldss00036
    • 2021-12-07

    IMGN-032

  • amateurIMGNimagineIMGN-032IMGN032
    • 2008-08-29
    99 min

    GS-415 Close-Up Live Shooting Married Woman Lover # 22 Married Woman, Mai (28 Years Old)

  • amateurGSsosoru x garcontumblerGS-415GS415h-101gs00415
    • 2021-12-10
    190 min

    NKKD-237 Dora Reco Ntr22 In-Vehicle Camera Was Watching The Whole Story

  • amateurmature womanNKKDjet eizomanji groupNKKD-237NKKD237nkkd00237
    • 2021-12-14
    127 min

    KTRA-356E Sex Education Nakamura Rio Out Of Daddy Torio'S Shaved Pussy

  • rio nakamuracreampieblowjobKTRAke toraibuk tribeKTRA-356eKTRA356eh-094ktra00356e
    • 2021-12-25
    120 min

    BLOR-186 Big Pie, Big Ass, Whole Body Plump General Store Clerk Quiet And Calm Daughter Had A Lot Of Dirty Sex With A Lot Of Close Contact Berochu

  • amateurbig titsBLORbroccoli mousouzokubroccolibroccoliBLOR-186BLOR186blor00186
    • 2022-01-13
    129 min

    MEKO-222 “Aunt Rental” Service Returns 10 I Wanted To Have More Sex With An Erotic And Gentle Aunt Who Will Let Me Secretly Vaginal Cum Shot Sex If You Ask, So I Tried To Change It

  • amateurcreampieamateurMEKOmature woman laboMEKO-222MEKO222h-1160meko00222
    • 2022-01-24
    112 min

    PRBYB-080 Your “Dream” Will Come True/Akari Mitani

  • mitani akaribig titsbeautiful girlPRBYBintec incprecious beautyPRBYB-080PRBYB080h-706prbyb00080
    • 2021-11-20
    240 min

    SVS-074 Iki Hell Limit Torture 4 Hours 10 Women Who Are Dominated By Pleasure And Cum Convulsions Vol.2

  • sayuki mogami nishida karinabdsmSVSavs collector savsSVS-074SVS074svs00074
    • 2022-02-04
    150 min

    BBAN-362 Intimidation Ca Lesbian Squirting Climax Domaso Training Attacked At A Flight Destination Where Help Does Not Come Miyuki Arisaka Aoi Rena

  • arisaka miyuki bluebig titssquirtingBBANbibianBBAN-362BBAN362bban00362
    • 2022-02-11
    180 min

    MIDV-053 Is It Okay To Go Home All Of A Sudden? Assault Delivery Sex To The House Of Kun Who Loves Boyne!! It'S Full Of Boobs!! Mizuura Sakura

  • minamata sakurabig titsslutMIDVmoodyzgoemonmoodyz divaMIDV-053MIDV053midv00053
    • 2022-02-11
    120 min

    MEYD-739 Rex Pu Demon Who Strengthened Me Who Was A Student Finishes His Prison Term, And I Became A Married Woman Again ● 10 Years Over Seeding Pursuit Mai Hanakari

  • flower huntingcreampiesingle workMEYDtameike gorokogoro kindaichiMEYD-739MEYD739meyd00739
    • 2022-02-18
    120 min

    JUL-868 Neighborhood Camp Ntr My Wife Who Has Been Vaginal Cum Shot Many Times In The Tent [Viewing Attention] Cuckold Video Kuriyama Rio

  • rio kuriyamacreampiemature womanJULmadonnakitorune kawaguchiJUL-868JUL868jul00868
    • 2022-02-19
    148 min

    KATU-095 Tall Body X Huge Breasts X Big Areola Dosukebe Wife Nampa Hami Ass Miniskirt Gal Is A Super Spear Man!

  • amateurbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-095KATU095katu00095
    • 2022-02-23
    95 min

    IENF-195 It Was The First Time I Graduated From Being A Virgin And I Wanted To Play With Her! My Perverted Bracon Sister Who Loves My Virgin Brother Is Jealous About Her Brother That She Was Made For The First Time, And Gets Impatient! “My Brother'S

  • yokomiya nanami yuzu shirakawacreampieslutIENFienergyienfIENF-195IENF1951ienf00195
    • 2022-02-23
    227 min

    SW-833 You Want Me To Wear Bloomers! This Pervert! 2 The Younger Sister Of A Bracon Girl Who Really Wants To Have Sex With Her Older Brother Discovered Her Brother'S Hidden Bloomers Gym Wear!! I Got A Full Erection On My Sister'S Bloomers Gym Wear, F

  • amateursisterSWswitchlight fujimaswitch switchSW-833SW8331sw00833
    • 2022-02-25
    120 min

    MIDV-061 Kotone Hana, An Irritable Female Teacher Who Has Been In A Circle

  • kotonekadeepthroatsingle workMIDVmoodyzhirokoji osakimoodyz divaMIDV-061MIDV061midv00061
    • 2022-03-10
    135 min

    STARS-526 Popular Erokawa Cosmetologist Minamo Is Actually A Ridiculous Kiss Demon.

  • minamoSTARSsod createk westSTARS-526STARS526
    • 2022-02-25
    185 min

    GHNU-85 Heroine Iki Hell Dream Squadron Mystic Ranger

  • mizutani aoi kano hanalesbianGHNUgigakawamori shigeGHNU-85GHNU85
    • 2022-03-05
    185 min

    CMC-272 Mania Chiba'S Pleasure Well-Trained Violence Training Instructions Best 4

  • minako huahara watch earlyCMCcinemagicotoko noritasucollectCMC-272CMC272cmc00272
    • 2022-03-11
    150 min

    MIDV-071 A Female Employee Who Hated Her Boss'S Breast Feces Breast Cum Due To Breast Harassment The Nechinechi Sexual Feeling Is Too Strike And Broken By Sexual Intercourse With Rubbing Iki Cum Shot Fumika Nakayama

  • nakayama fumikacreampiebig titsMIDVmoodyzgoemonmoodyz divaMIDV-071MIDV071midv00071
    • 2022-02-23
    70 min

    SPRL-069 Itomel Beam / Mel Ito

  • itou merusoloworkSPRLsuperlativeSPRL-069SPRL069n-1498sprl069
    • 2022-04-12

    MAAN-768

  • amateurMAANprestige premiumMAAN-768MAAN768
    • 2022-04-17

    SIMM-721

  • amateurSIMMshirotomanmanSIMM-721SIMM721
    • 2022-04-21

    STARS-545 Somehow,I was happy with the rear,and I was so tired that I had all-you-can-eat. Mei Miyajima

  • mei miyajimabeautiful girldramaSTARSsod createnao masakiSTARS-545STARS545
    • 2022-04-25

    SACZ-136

  • amateurSACZSACZ-136SACZ136
    • 2022-04-30
    130 min

    GVH-398 Naka-Iki Development 3 Nights 4 Days Satsuki Ena

  • ena satsukicreampiesingle workGVHglory questkimura hajimeGVH-398GVH398gvh00398
    • 2022-05-06
    120 min

    NKKD-257 Shiori Tsukada, A Busty Wife Who Was Inserted By A Vulgar Unemployed Man'S Big Dick While Her Husband Was Away

  • shiori tsukadasingle workNKKDjet eizougroupNKKD-257NKKD257nkkd00257
    • 2022-05-07
    234 min

    MMMB-071 4 Hours Of Massive Vaginal Cum Shot In Menopause Ma Co ○ Of Sixty Age Fifty Wife

  • amateurcreampiebig titsMMMBmellow moonMMMB-071MMMB071mmmb00071
    • 2022-05-21
    130 min

    BREK-002 Perverted Masochist Mother Who Is Trained By Her Son And Writhes With Pleasure Aphrodisiac Kimeseku Incest/Domesticated Female Dog Mother/Restraint Graffiti Toy Blame 3P Ikuno Mitsuyo Sakura Yumiko Saionji Mio

  • mitsuyo ikuno yumiko sakuramature womanmomBREKglobal media entertainmentsadoshima jiroubreaking global media entertainmentBREK-002BREK002brek00002
    • 2022-05-12

    GREN-001

  • amateurGRENmercuryGREN-001GREN001



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free