h_093r1800263




HDKAMIAAIPXSHKDSSNIHODVADNAUKSMILKSTARSSQTEDASDGVHAWDMARAAVSAAUKGWANZDTTJUL

2020-10-08
98 min

ZEAA-054 Bukkake Married Woman Colleague'S Wife Playing With Group Semen Rei Aoki

  • rei aokicreampiemature womanZEAAcenter villagetenunextreme center villageZEAA-054ZEAA054h-086zeaa00054
    • 2020-10-22
    150 min

    FSDSS-117 Rookie Very Friendly Fresh College Student Avdebut Ena Satsuki

  • ena satsukibig titsbeautiful girlFSDSSfalenowild sevenfaleno starFSDSS-117FSDSS1171fsdss00117
    • 2020-10-26
    138 min

    HMNF-070 Hamed Rhythm 05

  • sachiko himari kinoshita himari hanazawabig titsHMNFhmjmcompany matsuonon fictionHMNF-070HMNF070h-172hmnf00070
    • 2020-10-27
    121 min

    KNAM-025 Complete Raw Style @ Sora # Neat Female College Student # Cute System # First-Time Enlightenment # Vaginal Crazy # Half Middle Half Outside # Massive Mr. Nakata Inoue Sora

  • sora inouecreampiesingle workKNAMfirst star100 raw styleKNAM-025KNAM025h-491knam00025
    • 2020-10-31
    150 min

    WAAA-004 Insert Up To 2.5 Cm Of Glans Ok! Libido Muramura Cheating Wife Bud Who Insists That It Is "Less Than Affair"

  • budcreampieblowjobWAAAwanz factorywanzWAAA-004WAAA004waaa00004
    • 2020-11-06
    150 min

    JUL-364 Ngr-Nagasare-Uncle Raped ● Nao Jinguji, The Bride Who Knew The First Climax

  • jinguji temple naobig titsmature womanJULmadonnajotaro tomiJUL-364JUL364jul00364
    • 2020-11-13
    140 min

    FFFS-022 Bring A Mature Woman! Married Woman Playing With Other Sticks All Of The Voyeur Documents 19-Big Breasts Mature Wife Edition- A Neat And Clean Wife Who Looks For

  • amateurmature womanslutFFFSmature woman private videos emmanuellemanji groupFFFS-022FFFS022fffs00022
    • 2020-11-19
    87 min

    REBD-511 Ibuki Naughty Sweet Sister Aoi Ibuki

  • aoi ibukisingle workREBDrebeccachikara sawamuraREBD-511REBD511h-346rebd00511
    • 2020-11-26
    182 min

    SW-740 Hey, You Want To Have Sex With Girls ○ Students, Right? Sweet Temptation! A Girl In The Neighborhood ○ A Really Naughty Invitation From A Student? !! A Dream-Like Event Happened! It'S A Shame For A Man To Not Eat A Set Meal, So It Was Deliciou

  • amateurSWswitchswitch switchSW-740SW7401sw00740
    • 2020-12-01
    139 min

    SDAB-156 Compliant Uniform Beautiful Girl Absolute Obedience Raw Saddle Creampie Sexual Intercourse Marina Saito

  • marina saitocreampieschoolgirlSDABsod createbacon tanakaone s youthSDAB-156SDAB1561sdab00156
    • 2020-12-12
    150 min

    DASD-779 I Was Told That I Had To Do This To Get Rid Of My Husband'S Scandals. Tanaka

  • nene tanakacreampiebig titsDASDdashiromichi hoseDASD-779DASD779dasd00779
    • 2020-12-20
    90 min

    OAE-205 Deep Impact Arisu Hana Aka

  • arisu akasingle workOAEaircontrolzampaOAE-205OAE205oae00205
    • 2020-12-25
    242 min

    MKMP-371 Iori Nanase Complete Best 4 Hours

  • iori nanasecreampiebig titsMKMPk m producemillionMKMP-371MKMP37184mkmp00371
    • 2021-02-07
    300 min

    YMSR-033 Mountain And Sky Omnibus Vol.007 7 People 5 Hours

  • amateurYMSRyama to sorasuperb.combosYMSR-033YMSR033ymsr00033
    • 2021-02-19
    126 min

    EVIS-337 Massive Aphrodisiac Oil Apply Nyuru Nyuru Climax Lesbian Esthetic

  • suzuya strawberry tojosquirtinglesbianEVISebisusan mousouzokubyakkoEVIS-337EVIS337evis00337
    • 2021-02-20
    62 min

    WKD-039 Affair Married Woman Secret Meeting Sexual Intercourse Record Reiko Kobayakawa

  • kobayakawa reikocreampiebig titsWKDwaap entertainmentk westwWKD-039WKD0392wkd00039
    • 2021-02-22
    114 min

    OPKT-028 Forbidden Pregnancy Ok Creampie Byte Airi Shiraishi

  • airi shiraishicreampiesingle workOPKTtoyohikoOPKT-028OPKT028opkt00028
    • 2021-04-02
    160 min

    HUNBL-040 A Woman Who Is Thrust Into A Humiliation Dick And Is Made To Endure So Much That Love Juice Drips Down Her Thighs While Serving Customers

  • amateurcreampieHUNBLhuntergeminihhh groupHUNBL-040HUNBL040hunbl00040
    • 2021-04-15
    117 min

    MYBA-033 Married Woman Petal Turning Miya Tanaka

  • miya tanakamature womansingle workMYBAhitozuma engokai emmanuelleihyo kairoiMYBA-033MYBA033myba00033
    • 2021-05-02
    121 min

    SCD-192 Yuna Amami, The Mother Of Fifty Who Gives Me An Erection Medicine And Is A Slut In Erotic Underwear

  • yuna amamimature womansingle workSCDrubykoji tsujiscoopSCD-192SCD192scd00192
    • 2021-05-07
    150 min

    EBOD-826 K Cup Sex Appeal Yo ● Tu ● Er Momono Yume Av Debut

  • tomono yumebig titssingle workEBODe bodytrendy yamaguchiEBOD-826EBOD826ebod00826
    • 2021-05-20
    117 min

    RCTD-402 Delusion Item Ultimate Evolution Series Event ● Brainwashing Telework-Kun

  • ayano kato yamamoto renkaslutRCTDrockettaro kanbeRCTD-402RCTD4021rctd00402
    • 2021-05-21
    120 min

    CAWD-213 M Woman Specialized Deriheru A Younger Female Boss Who Hates Looking Down When You Call Me ... Completely Obeyed And Speared Until An Antibody Was Made Reversal Of Position ● Mayuki Ito

  • maiyuki itocreampiedeepthroatCAWDkawaiizaku araiCAWD-213CAWD213cawd00213
    • 2021-06-05
    140 min

    PKPD-148 Amateur Saffle Document Half Middle Half Out Half Her I Cup Big Breasts Ol Saffle Riku And Creampie Sexual Intercourse Record Serina Riku

  • serina rikucreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-148PKPD148pkpd00148
    • 2021-06-19
    120 min

    JUL-612 After Having Sex With My Husband, My Father-In-Law Always Keeps Vaginal Cum Shot ... Ai Kano

  • ai kanocreampiebig titsJULmadonnajotaro tomiJUL-612JUL612jul00612
    • 2021-06-26
    160 min

    LULU-082 Eri Takigawa, An Unequaled Bitch Mom Who Vulgarly Squeezes Her Son'S Friend ○ Po With A Huge Breasts K Cup Until The Gold Ball Is Empty

  • eri takikawa misato arisawacreampiebig titsLULUlunaticsvagmanLULU-082LULU082lulu00082
    • 2021-07-14
    120 min

    FOCS-008 Leg Length Superb Style Debut Massage Shop I Managed To Consent To The "Sexual" Dogeza Who Challenges The Beauty With All My Heart! Sex! 3P! It ’S All Ok Until Misuzu Kashii, A Serious Angel Girl

  • kashii misuzubeautiful girlsingle workFOCSabc mousouzokufocusFOCS-008FOCS008focs00008
    • 2021-08-06
    150 min

    IPX-706 Eros Probability Orgasm Of A Woman Who Is Impatient, Impatient, Cums A Lifelong Transcendence Fuck Kaede Karen

  • karen kaedesquirtingblowjobIPXidea pocketmontissueIPX-706IPX706ipx00706
    • 2021-08-27
    101 min

    YST-253 I'M A Metamorphosis Who Drips Man Juice Even Though My Father-In-Law Treats Me As A Mouthful. Star Ameri

  • star americreampiedeepthroatYSTkoyachoYST-253YST253540yst00253
    • 2021-09-10
    150 min

    IPX-728 Immediately Slug Immediately Name Yariyari Gal'S Escort Reverse Nan Sex Randomly Called At Random Picking Up Girls Pakopako Sex Pilgrimage Yume Nishimiya

  • yume nishinomiyacreampieschoolgirlIPXidea pocketmametaro mamezawadishIPX-728IPX728ipx00728
    • 2021-09-10
    140 min

    JUL-695 Ngr-Nagasare-I Was Raped By My Brother-In-Law ● Ryo Ayumi, The Bride Who Knew The First Cum

  • ayumi ryomature womansingle workJULmadonnajotaro tomiJUL-695JUL695jul00695
    • 2021-09-15
    125 min

    GVH-294 Mother And Child Rape Miyu Tsubakihara

  • miyu tsubakiharacreampiemature womanGVHglory questtakahashi chitsujiGVH-294GVH294gvh00294
    • 2021-10-02
    118 min

    OBD-072 My Grandmother Miyuki Tsubasa

  • miyuki tsubasamature womangrandfatherOBDrubykatsumoku saburouOBD-072OBD072obd00072
    • 2021-11-19
    160 min

    JUL-775 Scandinavian Blonde Beauty Madonna Exclusive Decision Special! !! Clear Blue Eyes ... Clear White Skin ... Shaking Blonde ... Super Dense 3 Production Lily Hart

  • lily heartmature womansingle workJULmadonnamamezawa mametarouJUL-775JUL775jul00775
    • 2021-12-03
    175 min

    DVDMS-747 Aoi Kuraki, A Real Virgin Girl Who Grew Up In A Girls' School Consistently In Middle And High School "I Have Never Had A Chance To Interact With Men" A Highly Educated Elite Female College Student Loses Her Virginity Av Debut

  • kuraki aoisingle workDVDMSdeepssuttorune iwanagaDVDMS-747DVDMS747dvdms00747
    • 2021-12-03
    95 min

    VENX-094 Big Breasts Brother-In-Law'S Boobs Temptation-Erotic Gentle Boyne Sister-In-Law Comforting Me Who Was Frustrated By Her (← Actually Sexless And Frustrated) -Ayame Kinoshita

  • kinoshita ayamecreampiebig titsVENXvenuskanieincest vi nasuVENX-094VENX094venx00094
    • 2021-12-09
    180 min

    STARS-483 I'm Sorry, That Sense Of Distance. Three Seconds Before I Really Fell In Love, I Want To Fall In Love With Such A Child Once. Yura Kudo Her AV Debut

  • amateursoloworkSTARSsod createeasy matsumotosod starSTARS-483STARS483
    • 2021-12-18
    123 min

    ZOCM-014 The Boobs Are Too Big And The Uniform Is Fluttering And Burning! Rumored Bust 101Cm J Cup Uniform On The Net Is Too Good For A Beautiful Girl With Huge Breasts And A Filthy Woman Miso Suwon

  • suwon misocreampiebig titsZOCMthrilling girls the daydream tribetodothrilling girlsZOCM-014ZOCM014zocm00014
    • 2021-12-18
    120 min

    KSBJ-172 Domestic Affair-Brother-In-Law And My Fucker-Hitomi Hoshitani

  • hitomi hoshitaniblowjobsingle workKSBJksb kikaku emmanuellesakura ninKSBJ-172KSBJ172ksbj00172
    • 2021-12-23
    135 min

    STARS-451 Welcome To The Healing Paradise. Tropical Erotic Spa Mei Miyajima

  • miyajima meisoloworkSTARSsod createkashiwakura hiroshisod starSTARS-451STARS451
    • 2021-12-31
    133 min

    JUTA-127 The Best!! Fifty Wife'S First Take Off Av Document Hinano Kifune

  • kifune hinnocreampiemature womanJUTAjuku onna japan emmanuellefukaya eiichijuku onna japanJUTA-127JUTA127juta00127
    • 2022-01-13
    122 min

    FSDSS-347 Merciless Facial Ejaculation From A Choking Irama! Strong ● Jobo Jobo Squirting Restraint Sex Hiyori Yoshioka

  • hiyori yoshiokasquirtingbeautiful girlFSDSSfalenowild sevenfaleno starFSDSS-347FSDSS3471fsdss00347
    • 2022-01-14
    123 min

    BOBB-330 Superb I Cup X Big Breasts Wheel Boin “Minami Momo” Box Massage Licking Sucking Shaking Milk Full Course! A Must-See Is The Fizuri Sandwich That Rolls Around! Super Erotic Milk Fetishism Sex

  • minami peachbig titssingle workBOBBabc mousouzokuboinbb abcBOBB-330BOBB330bobb00330
    • 2022-01-15
    242 min

    KSBJ-176 20 People Pies Into A Slender Beautiful Mature Woman With A Tight Thin Waist

  • mio morishita hanasaki iancreampiemature womanKSBJksb kikaku emmanuelleKSBJ-176KSBJ176ksbj00176
    • 2022-02-04
    119 min

    SSIS-319 For Three Days When She Was Away, I Couldn'T Stand Her Best Friend'S J-Cup, And I Rubbed It And Buried It, And I Was Just Squirmed. Shioyo

  • shioyo arisu hana akabig titssingle workSSISs1 no 1 stylebungo maedaSSIS-319SSIS319ssis00319
    • 2022-02-05
    150 min

    MDBK-222 Miniskirt T Back School Girls 4

  • satoshi kuruki ichika matsumotocreampieschoolgirlMDBKbazookak taroMDBK-222MDBK222mdbk00222
    • 2022-02-11
    150 min

    EBOD-891 A 1-Month Cohabitation Document Between Cherry Boy And Ichika Seta I Tried To Serve My Brushes And Housework With All My Might With The Kindness Of A Whip Whip Body And Possession

  • kazuhana setacreampiebig titsEBODe bodymichiru arashiyamaEBOD-891EBOD891ebod00891
    • 2022-02-19
    242 min

    NASH-652 A Grandmother Who Reclaimed The Pleasure Of The Cum That Was About To Be Forgotten By Her Grandson'S Big Dick Past Sixty Years 4

  • amateurcreampiemature womanNASHnadeshikojun nagasawaNASH-652NASH652nash00652



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free