h 491dori00077




ADNHMNPPPDDASDDASDDTTMIDEWAAACAWDCESDSHKDVENXKSBJROYDHZGDHNDJULKBIMEYDSSIS

2021-01-23
150 min

HND-935 Rookie Niko Niko Smile Ntr Angel My Boyfriend Is Cheating, So I Made My Av Debut And Put It Out In The Raw Sperm Vagina (But Actually I Like Being Cuckold, So I'M Rather Excited ... Lol) Kamo Nagi

  • kamo nagicreampiebeautiful girlHNDhon nakamametaro mamezawaHND-935HND935hnd00935
    • 2021-01-28
    108 min

    SPRD-1367 After All, The Older Wife Before The Remarriage Partner Is Good ... Shoko Tokuyama

  • shoko tokuyamacreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1367SPRD136718sprd01367
    • 2021-01-29
    240 min

    BRTM-017 "Well, It'S A Little Weird ..." To An Amateur Girl Who Is Frightened, "I Have Money" And Even Anal And Restraint Training! 4 Hours Containing The Women Who Fell To The Meat Guy ● With Momentum

  • amateuranalamateurBRTMk m producepermablack real burakku rearuBRTM-017BRTM017172brtm00017
    • 2021-02-06
    120 min

    SSNI-981 Belokis Training Diary Of A Perverted Middle-Aged Father Tame A Sailor Girl Yuumi On

  • evening beautybig titsuniformSSNIs1 no 1 stylerokusaburo mishimaSSNI-981SSNI981ssni00981
    • 2021-02-27
    239 min

    GAVHJ-033 Gachinanpa A Beautiful Married Woman 6! Raw Saddle To A Frustrated Wife With An Erotic Switch With My Amazing Tech! 10 Consecutive Vaginal Cum Shot! 4 Hours!

  • amateurcreampiebig titsGAVHJgraffiti japangati graffiti japanGAVHJ-033GAVHJ03348gavhj00033
    • 2021-03-06
    230 min

    HUNTA-962 "Please Pollute My Wife" I Am Excited To Take A Voyeur Of The Appearance Of My Wife Being Trained By Another Person On A Business Trip And Squirming With A Face I Have Never Seen.

  • amateurHUNTAhunterkawajirihhh groupHUNTA-962HUNTA962hunta00962
    • 2021-03-07
    480 min

    VENX-015 Immediately After I Got Acme To Satisfy My Dirty Mother, I Slammed My Sensitive Omako Again! Haste! Revenge Piston Sex Omnibus 8 Hours

  • amateurcreampiemature womanVENXvenusfakecest winntersVENX-015VENX015venx00015
    • 2021-03-07
    125 min

    DNJR-045 "Can You Submit To Me?" Erina Oka, A Small Devil After School Who Takes A Man As A Handball And Soaks In A Sense Of Superiority

  • hill erinablowjobbeautiful girlDNJRdog daydreamersdog manDNJR-045DNJR045dnjr00045
    • 2021-03-13
    120 min

    EYAN-165 Sex Appeal Munmun Busty Wife Waiting For A Cleavage Exposure Pick-Up Between Mom Friends! Raw Saddle Nasty Reverse 3P Fuck As It Is

  • amateurcreampiebig titsEYANe bodykyoseiwives of hanasagariEYAN-165EYAN165eyan00165
    • 2021-04-10
    235 min

    HOIZ-017 Hoi Hoi Punch 9 ~ Love With Busty School Girls Deredere Hentai Sex ~ Amateur Hoi Hoi Power, Teens, Beautiful Girls, Amateurs, Icharab, Uniforms, Clothes, Cum Swallowing, Big Butt

  • amateurbig titsschoolgirlHOIZshirouto hoihoi mousozokuHOIZ-017HOIZ017hoiz00017
    • 2021-04-17
    150 min

    HND-972 Chosen As A Semi-Grand Prix In The Local Yukata Contest, It'S A Healing System, But It'S Super Sensitive! Moreover, Rikejo Of A Prestigious University Makes A Vaginal Cum Shot Av Debut! !! Active Female College Student Miona

  • amateurcreampieHNDhon nakainaballHND-972HND972hnd00972
    • 2021-04-22
    105 min

    SPRD-1400 Son-In-Law Mother-In-Law Sumire Shiratori Was Messed Up By Her Sexually-Minded Son-In-Law

  • shiratori shiratorimature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1400SPRD140018sprd01400
    • 2021-05-21
    160 min

    JUL-585 Continued To Be Squid By Uncontrollable Copulation Of My Son'S Friend ... Momoko Isshiki

  • momoko isshikibig titsmature womanJULmadonnaamazing meatJUL-585JUL585jul00585
    • 2021-05-21
    120 min

    CAWD-213 M Woman Specialized Deriheru A Younger Female Boss Who Hates Looking Down When You Call Me ... Completely Obeyed And Speared Until An Antibody Was Made Reversal Of Position ● Mayuki Ito

  • maiyuki itocreampiedeepthroatCAWDkawaiizaku araiCAWD-213CAWD213cawd00213
    • 2021-06-24
    115 min

    SPRD-1430 Much Better Than My Husband ... Yori Sorami

  • yori soramimature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1430SPRD143018sprd01430
    • 2021-06-25
    80 min

    MBRAP-024 The Student Is S. / Minami Sano

  • himesaki hanasoloworkMBRAPspice visualMBRAP-024MBRAP024
    • 2021-07-28
    200 min

    HHH-239 Amateur'S Secret Video I Suddenly Put Out Ji Po While Hemming In The Fitting Room.

  • amateuramateurHHHtriple hrasukaruHHH-239HHH23978hhh00239
    • 2021-08-13
    150 min

    SSIS-144 Yua Mikami'S Gorgeous Dirty Dream Voice

  • yua mikamibig titsslutSSISs1 no 1 styletake dSSIS-144SSIS144ssis00144
    • 2021-08-20
    120 min

    HMN-031 Tipsy Creampie Sex Akari Mitani Can Be Slut At High Speed Pile Driving Cowgirl Even If You Get Drunk! !! ??

  • mitani akaricreampieslutHMNhonnakataiga kosakaiHMN-031HMN031hmn00031
    • 2021-10-02
    150 min

    YMDD-246 Amateur Observation Monitoring-Snake Tongue Anaconda Yumika Saeki Is The Director Of Promotion! Close Contact 72 Hours Pillow Business!

  • yuka saekicreampieblowjobYMDDmomotarou eizou shuppanteam pine angelsjaku momoYMDD-246YMDD246ymdd00246
    • 2021-10-01
    153 min

    MIFD-181 If You Are A Newcomer Once, You Will Want To Fuck Again! A Sex Genius Who Forgets To Work Even Though It Is A Natural Body! Av Debut Rion Kanami

  • rion kanamiblowjobbeautiful girlMIFDmoodyzusapyonmoodyz freshMIFD-181MIFD181mifd00181
    • 2021-10-08
    125 min

    HUNBL-064 My Sister Suddenly Started Putting On Weird Makeup, So I Put It Back Cute And Spoiled!

  • amateurcreampiesisterHUNBLhuntergeminihhh groupHUNBL-064HUNBL064hunbl00064
    • 2021-10-22
    150 min

    HMN-062 Dream? Or Is It Employment? An Active Female College 4Th Grader Who Is Worried About The Future Wants To Take A Step Forward And Makes A Vaginal Cum Shot Av Debut! !! Rinka Sakurazaka

  • rinka sakurazakacreampiebig titsHMNhonnakamamezawa mametarouHMN-062HMN062hmn00062
    • 2021-10-22
    120 min

    JUL-757 Alone Under The Same Roof. Drowning In A Dense Sweaty Sexual Intercourse With A Wet And Transparent Housekeeper ... Rin Ogawa

  • rin okaebig titsmature womanJULmadonnakimura hiroyukiJUL-757JUL757jul00757
    • 2021-10-22
    190 min

    SSIS-225 * No Script For The First Time In The Entertainment Life! !! Gonzo! No Makeup! Anything Ants! [Gravure] Miu Nakamura'S Lewd Nature Bare Sex! !! A Super Rare Eros 200% Video That Is Too Raw And Spoiled On A Hot Spring Trip Alone With A Apt

  • miu nakamurasingle workSSISs1 no 1 stylezack araiSSIS-225SSIS225ssis00225
    • 2021-10-22
    175 min

    SSIS-211 What If The Mistress In Front Of Me Was A Super Popular Av Actress? Don'T You? ?? Yua Mikami

  • yua mikamibig titssingle workSSISs1 no 1 styletake dSSIS-211SSIS211ssis00211
    • 2021-11-11
    124 min

    SPRD-1478 Tabiji Mother And Child Traveling Yuri Tadokoro

  • yuri tadokoromature womanmomSPRDtakara eizoumishima rokusaburoaleddinSPRD-1478SPRD147818sprd01478
    • 2021-11-11
    145 min

    SW-811 The Morals Of The Doctor Collapsed, And The Patient With Big Breasts Got Horny And Sexually Harassed! !! However? ?? I Pretended To Be A Treatment For A Patient Who Wanted A Lustful Ji ○ Port And Got Fucked! !!

  • amateurbig titsSWswitchcambridgeswitch hibinoSW-811SW8111sw00811
    • 2021-11-12
    120 min

    PRED-359 Her Scent On Her Body, I'Ll Overwrite It Belokissed And Blown, Weekend Swamp Sex With Her Best Friend Who Seems To Melt The Whole Body With Saliva Tsukino Luna

  • tsukino lunacreampieblowjobPREDpremiumtakarase hironorielegancePRED-359PRED359pred00359
    • 2021-11-12
    160 min

    MVSD-486 Customs Tonight Av Actress Minami Hatsukawa Infiltrates The Rumored Apt Customs! Raw Saddle Creampie Experience Report For Amateurs! Minami Hatsukawa

  • hatsukawa minamicreampieslutMVSDm s video groupms video groupMVSD-486MVSD486mvsd00486
    • 2021-11-20
    242 min

    NASH-603 Middle-Aged And Older Dense Copulation 10 People 4 Hours Of Mature Sexual Pleasure Intertwined

  • rieko hiraoka toshiko imaiNASHnadeshikoNASH-603NASH603nash00603
    • 2021-12-04
    186 min

    SORA-349 Excavation Of God Yariman "He Only Does It Three Times A Day ..." The Naive Jd Is Bottomless And Nasty! Shun Iki Systemic Erogenous Zone Premature Ejaculation Ma ● Ko Cum 90 Times! !! Natural Mizuki

  • natural mizukisingle workSORAyama to sorahimu lockSORA-349SORA349sora00349
    • 2021-12-25
    240 min

    ENKI-044 Sexual Desire Unequaled Pre-Ass Metamorphosis Erotic Daughter Ami-Chan Analyzing Cock Data Perverted Deviation Value Max Of Nasty Teri Faction Intrine Raw Pies Seeding Press Ring ●

  • amateurcreampiedeepthroatENKItoxic bacchanalENKI-044ENKI044enki00044
    • 2021-12-24
    120 min

    HMN-089 Can You Be An Av Actress With A Mask On Because It'S A Rookie In This Time? The Minimum Girl Who Is Currently Closed For Voice Actor Debuts With A Vaginal Cum Shot For The First Time In About A Year Otowa Shizora

  • otowa shisoracreampiesingle workHMNhon nakatiger kosakaiHMN-089HMN089hmn00089
    • 2021-12-25
    150 min

    GNAX-062 Screaming Married Woman'S First Shot In The Daylight That Can Never Be Shown To Her Husband Document Edition Sayuri Akiyoshi 36 Years Old

  • akiyoshi sayuricreampiesingle workGNAXnagiranagira kenzonagira nagiraGNAX-062GNAX062gnax00062
    • 2021-11-25

    YAHO-022

  • amateurYAHOamateur yahooYAHO-022YAHO022
    • 2022-01-14
    120 min

    MVSD-495 Plunder Revenge Piston Ntr I Witnessed The Sex Between My Childhood Friend And My Best Friend Who Has Always Liked!? I Was Crazy By Betrayal And Turned Into A Scrap, For 3 Days When She Was Away, I Kept Pistoning Vaginal Cum Shot Until She F

  • akari neocreampiesquirtingMVSDm s video groupMVSD-495MVSD495mvsd00495
    • 2022-01-27
    117 min

    NHDTB-624 The Intruder'S Erection Ji ○ Port Is Suddenly Thrust Into The Anal And Screams, But It Gradually Becomes Comfortable And The Anus Is Spree Beautiful Ass 3

  • amateurbig titsdeepthroatNHDTBnatural highrafting maeshiroNHDTB-624NHDTB6241nhdtb00624
    • 2022-01-27
    121 min

    RCTD-447 Dirty Talk Female Ana 28 Clothes Big Breasts Are Cool! Gorgeous H Cup Kitano Mina Sp

  • mina kitanobig titssingle workRCTDrockettaro kanbeRCTD-447RCTD4471rctd00447
    • 2022-02-04
    170 min

    BBAN-360 Two Beautiful Wives With A G-Cup Powerful Body And A Slender Body With Super-Grade Erotic Pheromones Coming Out For 24 Hours Each Other'S Bodies With A Slow And Sticky Tongue Unique To A Miraculous W Lesbian Ban Married Woman Mio Megu Tahara

  • mio meg rinka taharabig titslesbianBBANbibianBBAN-360BBAN360bban00360
    • 2022-02-05
    127 min

    AMBI-150 When I Consulted A Senior In Love, I Was Taught Baby-Making Sex! Urara Kanon

  • hanaoto uraracreampieschoolgirlAMBIplanet plusdirector oanbibaresotsuAMBI-150AMBI150h-237ambi00150
    • 2022-02-23
    115 min

    STARS-546 Sensitive G Cup Beauty Big Tits Mania MAX Full Course! I Made 10 Shots With My Boobs Special! !! Himari Asada

  • asada himaribig titssoloworkSTARSsod createmonsod starSTARS-546STARS546
    • 2022-02-18
    210 min

    HUNTB-211 It Doesn'T End With Just Being Lucky! The Excitement Does Not Subside To The Super Defenseless Erotic Ass Girl... I Can'T Stand The Lucky Erotic Ass Of A Cute Girl And I'M Rubbing! Rolled Up Licking! Saddle Roll Up!

  • amateurcreampieblowjobHUNTBhunterkiteretsuhhh groupHUNTB-211HUNTB211huntb00211
    • 2022-02-19
    242 min

    UMSO-435 10 Married Woman Gonzo Who Recorded The Whole Story Who Enjoys Affair Affair Affair With A Middle-Aged Man Vol.03

  • kana suruga ayaka makimuramature womanUMSOk m produceumanamiUMSO-435UMSO435umso00435
    • 2022-02-19
    134 min

    AGMX-112 Reiwa'S Naked Observation Encyclopedia Vol.3

  • amateuramateurAGMXsex agent daydreamersyosukesex agentAGMX-112AGMX112agmx00112
    • 2022-03-10
    128 min

    DRPT-009 Fumi Ayakawa, A Sensitive Married Woman Who Feels So Much That Breast Milk That Has Been Carefully Stimulated By Her Nipples At An Esthetic That She Started Going To Improve Her Postpartum Figure

  • ayagawa fumisingle workDRPTdenno rasputinlemonheart nakajimaDRPT-009DRPT0091drpt00009
    • 2022-03-12
    240 min

    PRMJ-163 4 Hours 2 Massive Launch On The Plump Big Breasts And Big Butt Of The Finest Muchimuchi Mature Woman

  • amateurcreampiebig titsPRMJpremium mature woman emmanuelllePRMJ-163PRMJ163prmj00163
    • 2022-03-18
    120 min

    JUL-912 During My Wife'S Pregnancy, Even Masturbation Was Forbidden, And I Have Seeded Sex With My Sister-In-Law Yu Who Came To Tokyo Many Times... Shinoda Yuu

  • shinoda yucreampiemature womanJULmadonnakitorune kawaguchiJUL-912JUL912jul00912



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free