h 127ysn00593




AUKGMARALULUMILKROYDFSDSSPPPDSSNIMVSDMIAADASDNACRMIDEBLKKBICJODHDKASQTENNPJSAN

2020-09-21
125 min

NDWQ-008 Throat Demon Training Throat Onaho Birth Edition Ai Nami

  • ai imicreampiedeepthroatNDWQtoyohikozarakiseiunkai ekusutorimuNDWQ-008NDWQ008ndwq00008
    • 2020-09-21
    105 min

    HNM-008 As One M Woman... Erie Akira Erie'S Body And Spirit Are Overrun

  • aki erie arai erie yuka osawasquirtingbdsmHNMavs collector susubashisuiblack mariaHNM-008HNM008hnm00008
    • 2020-09-25
    300 min

    XRW-927 Voyeur! !! Affair Secret Meeting Site 5 Hours Rec

  • amateurmature womanXRWreal worksmanjiroreal real worksXRW-927XRW927172xrw00927
    • 2020-10-10
    120 min

    IPX-557 I'Ve Been Lustful For The Unequaled Pant Voice Of My Neighbor'S Resident ... All-You-Can-Eat Young Chi Po! !! Manager Ntr Minami Aizawa

  • minami aizawasingle workdramaIPXidea pocketzampadishIPX-557IPX557ipx00557
    • 2020-10-23
    116 min

    CRDD-004 Teen Only Raw Creampie Western Backstreet Nampa 003

  • amateurcreampiebig titsCRDDcrazy walkerCRDD-004CRDD004h-1518crdd00004
    • 2020-10-24
    120 min

    NNPJ-407 Is It Okay To Go Home Because I Pay The Rent For One Month? ?? Guard Firming Chest Loosening Professional Student Grandpa Is An American! Healthy Quarter Basketball Favorite Girl Beautiful Big Tits College Student Goes Crazy With White Eyes

  • amateurblowjobbeautiful girlNNPJnanpa japanno directorNNPJ-407NNPJ407nnpj00407
    • 2020-11-06
    140 min

    HODV-21522 Underwear Fetish Voyeur Ntr Former Lingerie Salesman Young Wife Chaoyang Ema

  • chaoyang emalingeriesingle workHODVh m pHODV-21522HODV215225642hodv21522
    • 2020-11-27
    139 min

    FONE-124 Great Fire Pot, See! Idol Aspiring Slender Amateur Beautiful Girl Caught On The Net Yo Aoi

  • amateuramateurbeautiful girlFONEfirst starplus first starFONE-124FONE124h-491fone00124
    • 2020-12-12
    180 min

    IPX-574 Beautifully Iku. Pleasure Climax First Experience 4 Production Special -Beautiful Nova- [Exclusive 2Nd] Iyona Fujii

  • iyo fujiisquirtingblowjobIPXidea pocketzampadishIPX-574IPX574ipx00574
    • 2020-12-12
    120 min

    IPX-583 Forbidden After School Female Teacher And Student Immoral Belokiss Sexual Intercourse Amami Tsubasa

  • amami tsubasablowjobsingle workIPXidea pocketdishIPX-583IPX583ipx00583
    • 2020-12-17
    130 min

    DVDMS-613 Big Penis Immediately Saddle Screwed From The Back To The Pita Pan Butt Of The Boss'S Wife! While Enduring The Pant Voice With Sudden Pleasure, I Could Not Endure It With The Intense Piston Of My Subordinate Employees And Fell Climax! Next

  • amateuramateurDVDMSdeep sswing nagaseDVDMS-613DVDMS613dvdms00613
    • 2020-12-17
    120 min

    SSNI-942 Yura Kano Who Broke Her Glasses And Fell Asleep With Her Almost Blind Best Friend

  • yura kannosingle workdramaSSNIs1 no 1 stylemametaro mamezawaSSNI-942SSNI942ssni00942
    • 2020-12-27
    119 min

    BIJN-191 The Document Cum Sex With Instinct Bare Tall Beautiful Wife Agony Wheel ● Crazy Kotono Nanasaki

  • kotono nanasakicreampiesingle workBIJNbijin majo emmanuelleBIJN-191BIJN191bijn00191
    • 2021-01-10
    117 min

    SQTE-355 No Matter How Tired I Am, My Erotic Ass Wife Will Hold Me Every Day. Aoi Kururugi

  • aoi kururugiblowjobsingle workSQTEs cuteSQTE-355SQTE355sqte00355
    • 2021-01-22
    165 min

    AOZ-295Z Married Woman On The Way Home From Nursery School Pushing Breast Milk Double Hole ●

  • amateurAOZaozora softAOZ-295ZAOZ295Zh-308aoz00295z
    • 2021-01-24
    79 min

    PPHC-001 Spanky Communication "Maid Breeding Edition" Ai Sakaki Mayo Sakura

  • sakaki ai mayo cherry blossoms at nightblowjobPPHCspanky.communications daydreamerskanchi okumuraPPHC-001PPHC001pphc00001
    • 2021-02-13
    120 min

    DBER-099 Devil'S Flesh Tremor Penetration Machine Part2 Seven Sad Sensitive Female Bodies Who Continue To Ascend To Heaven Without Any Means To Do While Struggling With A Cruel Device That Pushes Up To The Deep Layers Of The Secret With Tremendous Vi

  • maki kyoko kanae lennonbdsmDBERbabyentertainmentred babeDBER-099DBER099dber00099
    • 2021-02-19
    240 min

    MBM-267 Amateur Daughter Lesbian Pick-Up! A World Of Fluttering First Lesbians Where Straight Amateurs Immerse 12 People 4 Hours

  • amateuramateurlesbianMBMprestigegaro sasazukambmMBM-267MBM267118mbm00267
    • 2021-02-27
    230 min

    CLUB-632 Complete Voyeurism A Case Where I Made Friends With Two Beautiful Wives Living In The Same Apartment And Brought Them To The Room And Had Messed Up Sex. Part 39

  • amateurcreampieCLUBhentai shinshi clubCLUB-632CLUB632club00632
    • 2021-03-01
    300 min

    DKSB-108 After All, Women Like Ji Po! ?? When I Showed 30 Beautiful Women Who Picked Up A Full Erection, It Seemed That I Was In Estrus And Made Me Do Various Lewd Things. 5 Hour Special

  • amateuramateurblowjobDKSBoffice k sks bestDKSB-108DKSB10836dksb00108
    • 2021-03-25
    121 min

    FSDSS-193 Super Luxury Men'S Esthetic Faleno Now The Back Op Campaign Is Underway! Yui Shirasaka

  • yui shirasakablowjobcosplayFSDSSfalenomusetafaleno starFSDSS-193FSDSS1931fsdss00193
    • 2021-03-27
    130 min

    SQTE-364 Chiharu Miyazawa If You Can Spend A Day With Her Lustful Girlfriend

  • chiharu miyazawablowjobbeautiful girlSQTEs cuteSQTE-364SQTE364sqte00364
    • 2021-05-13

    SMUK-042

  • amateurSMUKhairy amateursSMUK-042SMUK042
    • 2021-06-15
    480 min

    KTRA-305 All Are Over G Cup! Big Breasts Sister 10 People Recording 8 Hours 2 Discs

  • ann wakamoto rina serizawacreampiebig titsKTRAk tribeKTRA-305KTRA305h-094ktra00305
    • 2021-06-17
    150 min

    KTKC-117 Jogging Big Breasts Girl Riku (I-Cup) A Sweet Girl Who Unconsciously Provokes By Shaking The No Bra Boyne With A Protruding Nipple.

  • amateurbig titsamateurKTKCkitixx mousouzokubig titsKTKC-117KTKC117ktkc00117
    • 2021-06-19
    120 min

    NNPJ-453 "I Was Flirted With My Boyfriend A While Ago ..." I Picked Up A Weak Woman And Took It Home. The Inside Out Of Loneliness! ?? An Amateur Girl Who Was Messed Up Until Morning. Alice (21 Years Old)

  • amateurcreampieamateurNNPJnanpa japanNNPJ-453NNPJ453nnpj00453
    • 2021-06-20
    120 min

    SPZ-1106 Watching Private Room Av With A Mature Woman Alone

  • amateuramateurblowjobSPZstar paradisestar paradiesSPZ-1106SPZ1106h-254spz01106
    • 2021-07-03
    109 min

    MGMJ-050 Pantyhose Legs Kitchen Aino Rei

  • aino rei sena asamislutsingle workMGMJmegamibeautiful goddess fetishMGMJ-050MGMJ050mgmj00050
    • 2021-07-09
    140 min

    EBOD-839 Ultimate Slim Big Breasts Extreme Beauty Proportion Pleasure Seeding Affair Trip That Mistress Shakes Herself To The Extent That It Is Likely To Warp Miyuki Arisaka

  • arisaka miyukicreampiebig titsEBODe bodymishima rokusaburoEBOD-839EBOD839ebod00839
    • 2021-07-30
    170 min

    PRED-329 W Exclusive Slut Special I Was Made To Cum Over And Over Again By Libido Munmun Female Boss On A Employee Trip. Yuki Takeuchi Mami Sakurai

  • yuki takeuchi mami sakuraicreampieslutPREDpremiumzampaelegancePRED-329PRED329pred00329
    • 2021-08-06
    160 min

    MIAA-484 The Gal Who Moved To The Countryside Did Not Do Too Much And Looked Down On The De M Man And Made A Mouth Blow Job Karen Yuzuriha

  • karen kaedecreampieblowjobMIAAmoodyzoosaki hirokoujiminna no kikatanMIAA-484MIAA484miaa00484
    • 2021-08-20
    240 min

    REXD-377 A Trap Charged In Protein! Let'S Finish The Female Body Modification Plan With This!

  • amateurcreampieREXDreddogroupREXD-377REXD377rexd00377
    • 2021-09-07
    201 min

    SDMM-097 Magic Mirror Midsummer Swimsuit Beauty Limited A Virgin Pretending Unequaled Man Is A Hard Piston! !! Ignore It No Matter How Many Times I Go And Restart The Gun Thrust! Incontinence / Convulsions Tightly Tightened Omako To Melt Raw Vaginal

  • amateurcreampiebig titsSDMMsod createsaijou akiramirror noSDMM-097SDMM0971sdmm00097
    • 2021-10-02
    227 min

    SORA-337 Blow Friend Cum Swallowing Date Fleshly Plump Ol Is Apt Cum Incontinence! 6 Shots Of Swallowing While Exposing Dada Leaking Urination! !! Tamaki Kurumi

  • tamaki walnutblowjobsingle workSORAyama to soradenchuuSORA-337SORA337sora00337
    • 2021-10-07
    174 min

    DANDY-782 Nice Ass Esthetician Who Does Not Move The Man Who Is Still Erected At All S-Shaped Ass Swinging Woman On Top Posture

  • minami kozue swanslutDANDYdandytanaka baconDANDY-782DANDY7821dandy00782
    • 2021-10-16
    145 min

    MMKZ-103 Big Ass Busty And Plump ♪ Yayoi Yoshino

  • yayoi yoshinosingle workMMKZmarrionmiyamoto kojirouirisMMKZ-103MMKZ103mmkz00103
    • 2021-10-23
    240 min

    BDSR-463 Of Course I'Ll Get Mad! ?? 14 Married Women Who Have Their Crotch Bitch Creampie 4 Hours

  • amateurcreampieamateurBDSRbigmorkalbanderas takedabig mocalBDSR-463BDSR46357bdsr00463
    • 2021-11-05
    155 min

    DOCP-328 I Became An Educator Of A New Female Employee I Raised A Naive Girlfriend Who Does Not Know Right Or Left Into A Meat Urinal That Can Be Done At Any Time

  • sakurada yua hanabara asukaDOCPprestigedoc premiumDOCP-328DOCP328
    • 2021-11-06
    200 min

    RNA-001 Amateur'S First Hanging Cum Shot [Beautiful Big Butt Married Woman Edition] I Tried To Put My Wife Living Next Door In A Mosquito Net ... Wakana Shiroyama

  • shiroyama wakanacreampieamateurRNApuramuranta maishirouto only plumRNA-001RNA001h-113rna00001
    • 2021-11-11
    205 min

    STARS-440 Climax Development Gakuburu Trembling A Petite Body And Screaming! First Big Cock Big Cum 3 SEX MINAMO

  • minamoSTARSsod createdainanasod starSTARS-440STARS440
    • 2021-11-12
    95 min

    GHNU-45 Lewd Phantom Erotic Attack Camera Phantom Nozo King Mahoro Kamiki

  • kamiki mahorosoloworkGHNUgigashiki masayoshiGHNU-45GHNU45
    • 2022-02-01
    129 min

    MILF-028 Pregnant Women Sex Sex When Women Become The Most Horny

  • amateurcreampieMILFlahaina tokaij milfMILF-028MILF028h-189milf00028
    • 2022-01-29
    110 min

    SQTE-400 This Child Is Dangerous!! Kitano Mina, The Woman That The Staff Made To Okazu

  • mina kitanobig titssquirtingSQTEs cutes cute s cuteSQTE-400SQTE400sqte00400
    • 2022-02-11
    190 min

    KBI-072 It Takes 5 Hours Until My Husband Comes Home. Ji ● Ko Inserted Non-stop Vaginal Cum Shot 12 Consecutive Vaginal Cum Shot

  • ariga minahocreampiesoloworkKBIprestigemasarupansakanbiKBI-072KBI072
    • 2022-02-18
    120 min

    JUL-878 I Wanted To Make My Wife And An Unequaled Junior Alone For 3 Hours... My Ntr Story Where My Wife Was Robbed By A Total Of 17 Shots Without Pulling Out A Pursuit Vaginal Cum Shot Without Pulling Out Sumire Kurokawa

  • sumire kurokawacreampiemature womanJULmadonnahiroyuki kimuraJUL-878JUL878jul00878
    • 2022-02-23
    124 min

    DLDSS-052 A Beautiful Secretary Covered In Shame And Body Fluids In-House Cuckold Sexual Intercourse Where Pain Can Not Be Suppressed Even Beside Her Husband Mino Suzume

  • suzume minosingle workDLDSSdahliaebiDLDSS-052DLDSS0521dldss00052
    • 2022-02-24
    138 min

    SPRD-1517 My Mother-In-Law Is Much Better Than My Wife... Rinka Tahara

  • rinka taharamature womansingle workSPRDtakara eizokon oriharualeddinSPRD-1517SPRD151718sprd01517
    • 2022-03-05
    118 min

    NACR-512 A Pheromone That Smells Like Sex Appeal! The Widow Landlord Of The Boarding House Akari Shinmura

  • akari shinmuracreampiebig titsNACRplanet plustoshionanakuruNACR-512NACR512h-237nacr00512



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free