h 086jrze00153




VENUEBODSHKDAVSAJUFEKBINNPJONEZMEYDFSDSSCHRVDASDHMNSQTEMIAANACRBBANCJODAPODROYD

2021-04-18
99 min

GMEM-028 Real Mistress Queen Full-Scale Training Ran Ichinose

  • ran ichinosesingle workGMEMavs collector snatsuki aoyamaavscollector s goldGMEM-028GMEM028gmem00028
    • 2021-04-22
    165 min

    NHDTB-519 A Cheeky Honor Student Who Disturbs Obscenity In The Hall Begins To Cry So Much That The Vagina Back Metta Thrust Fuck

  • amateursquirtingschoolgirlNHDTBnatural highvanilla sakuraiNHDTB-519NHDTB5191nhdtb00519
    • 2021-05-02
    114 min

    PKPD-144 Enjo Dating Creampie Ok 18 Years Old Little Girl Beautiful Girl Ichika Nagano

  • ichika naganocreampieschoolgirlPKPDfuck group and fun friends daydreamersPKPD-144PKPD144pkpd00144
    • 2021-05-11
    129 min

    KTRA-296e Creampie For Intrinsic Menhera Girls Akane Shiki

  • shiki akanecreampiebig titsKTRAk tribeKTRA-296KTRA296
    • 2021-05-20
    122 min

    FSDSS-230 Miraculous Resurrection Sex For The First Time In 300 Days, Moment Of Abstinence Super Opening Immediately Nonstop Iki Too Cum Orgasm 3 Production Yuko Ono

  • yuko onobig titssingle workFSDSSfalenoponyfaleno starFSDSS-230FSDSS2301fsdss00230
    • 2021-05-28
    140 min

    CLUB-642 I, A Swimsuit Enthusiast, Take A Sneak Shot Of A Busty Swimsuit Girl. Unequaled Ji ● The Whole Story Of Seeding And Mating With Po

  • amateurcreampiebig titsCLUBhentai shinshi clubCLUB-642CLUB642club00642
    • 2021-06-04
    140 min

    JUL-597 It'S Embarrassing, But I Want To Have A Rich Kiss. Mitsu Kikuda, A Married Woman Who Works In The Lipstick Development Department Of A Certain Cosmetics Manufacturer, Is 42 Years Old Av Debut!

  • mitsu kikudamature womansingle workJULmadonnamametaro mamezawaJUL-597JUL597jul00597
    • 2021-06-12
    134 min

    BEFG-002 Torture Decoy Investigator -Persona- Episode1 Sacrificial Bud Ruka Inaba Crying Crazy For A Cruel Capture Operation

  • inababdsmsingle workBEFGbabyentertainmentkikubongolden babeBEFG-002BEFG002befg00002
    • 2021-06-12
    111 min

    APNS-243 Played With My Niece'S Nipple "I'M Aching With A Pin Pin, Teasing My Nipple More ..." Hina Shinjo

  • hina shinjocreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-243APNS243apns00243
    • 2021-06-17
    150 min

    LZDQ-023 Former Local Station Female Announcer & Youth Idol Co-Star # First Lesbian Cum Number Challenge

  • narita tsumugi elena takedalesbianbeautiful girlLZDQlesreheavy smoky ishiirezure documentLZDQ-023LZDQ023lzdq00023
    • 2021-06-20
    134 min

    OPPW-097 Berokisu Soap Sora Shinohara

  • sora shinoharaanalsingle workOPPWopenipeni world mousouzokuhimu lockOPPW-097OPPW097oppw00097
    • 2021-06-25
    150 min

    MIDE-943 Sensitivity Exploding Body Spree Through All Day Nonstop Infinite Orgasm Kimeseku Squirting Super Climax Shoko Takahashi

  • shoko takahashibig titssquirtingMIDEmoodyzdragon nishikawamoodyz divaMIDE-943MIDE943mide00943
    • 2021-06-26
    241 min

    BDSR-452 The Strongest Shortcut That Will Definitely Come Out! Marshmallow Big Breasts, Model-Class Beautiful Breasts, Prepuri Nice Ass, Etc ... S-Class Daughter And Higher-Grade God Sex! 24 People

  • miku abe eternalbig titsbeautiful girlBDSRbig morkalyokohachiBDSR-452BDSR45257bdsr00452
    • 2021-07-08
    85 min

    MHAR-06 [Men's Beauty Treatment Salon Rumored In The Street] SEX 6 Out In The Back Op Negotiation Raw Squirrel To A Mature Masseuse

  • harata kyouko isoyama ekocreampieamateurMHARjukujo laboMHAR-06MHAR06
    • 2021-07-14
    160 min

    PPPD-940 Oppai And E-Body W Exclusive, Alice Kisaki Oppai Debut! Megaton J Cup First Iki Special

  • kisaki alicebig titssquirtingPPPDoppaiPPPD-940PPPD940pppd00940
    • 2021-07-17
    120 min

    NNPJ-460 Super Rare Amateur Country Girl Going To Tokyo File Undoubted Beautiful Girl Cuteness More Than Imagined Natural Beautiful Girl With Tohoku Dialect And 9 Free Creampies Sachiko-Chan

  • amateurcreampieblowjobNNPJnanpa japanNNPJ-460NNPJ460nnpj00460
    • 2021-07-30
    118 min

    DFE-055 I Have My Daughter Eat It. Yokomiya Nanami

  • yokomiya nanamicreampieuniformDFEwaap entertainmentsasanishikifearlessDFE-055DFE0552dfe00055
    • 2021-07-30
    103 min

    YSN-555 I'M A Home Guard, Bullying My Sister All The Time, Ria Hidou

  • riria hidocreampiesingle workYSNnonYSN-555YSN555h-127ysn00555
    • 2021-08-20
    240 min

    REXD-377 A Trap Charged In Protein! Let'S Finish The Female Body Modification Plan With This!

  • amateurcreampieREXDreddogroupREXD-377REXD377rexd00377
    • 2021-09-03
    120 min

    WAAA-093 Squirting Acme Tsukino Kasumi Sweaty On The Runaway Piston Of An Unequaled Advisor Who Lost Herself To A Growing Teen Big Tits

  • kasumi tsukinocreampiebig titsWAAAwanz factoryWAAA-093WAAA093waaa00093
    • 2021-09-09
    135 min

    SDDE-653 There Was A Man Who Could Stop The Time! Super THE REVIVAL * The Largest Number Of Victims In History, 9 Victims-Club Activity Girls Who Are Doing'summer Youth'

  • hachino tsubasa inaba rukacreampieSDDEsod createoota migiwasenzSDDE-653SDDE653
    • 2021-09-15
    135 min

    OVG-182 Do You Like The Blowjob Of Your Sister Who Loves Ochi Po?

  • kana morisawa kanako iioka natsu tojoblowjobslutOVGglory questOVG-182OVG182ovg00182
    • 2021-10-08
    121 min

    ROE-012 A Single Female Boss Who Missed Her Marriage And I ... -It Should Have Been A One-Time Mistake, But Drowning In Sex With Excellent Compatibility- Kyoko Ichikawa

  • kyoko ichikawabig titsmature womanROEmadonnabiba gonzomonroeROE-012ROE012roe00012
    • 2021-10-16
    124 min

    KTKL-099 The Boyish Girlfriend Got Acme. "I'M Really A Lustful Guy." Natsu (20)

  • amateurcreampieamateurKTKLkichikkusu mousou zokuroriKTKL-099KTKL099ktkl00099
    • 2021-11-05
    120 min

    DASD-933 As A Woman, I Accepted Her As My Best Friend Asked Me, And My Heart Became A Woman. Kawakami Nanami

  • kawakami nanamicreampiesingle workDASDdasmishima rokusaburoDASD-933DASD933dasd00933
    • 2021-11-20
    120 min

    BHG-042 Breast Face H Cup Active Gravure Av Debut! Sound Wind

  • sound windcreampiebig titsBHGgain corporationBHG-042BHG042bhg00042
    • 2021-12-04
    112 min

    EVIS-382 Super Oil Torture, Saliva, Man Juice Dripping Lesbian Esthetic

  • kato camellia kaoru natsuki nanami yualesbianslutEVISebisusan mousou zokubyakkoEVIS-382EVIS382evis00382
    • 2022-01-11
    125 min

    KTRA-364 Imoto No Necchori Ma ○ Ko Messing With Aihara Tsukiwa

  • aihara tsukihacreampiebeautiful girlKTRAk tribeKTRA-364KTRA364h-094ktra00364
    • 2022-01-14
    270 min

    SKMJ-245 Amateur Beautiful Girl And Remote Control Vibe Walk 4 - Sby Ward Edition - “I Can'T Stand It Anymore...//” Girls Who Tremble In The Crowd And Go Alive! It'S The First Shame Play In My Life And It'S A Rainy Day Erotic Switch On! Daring Car Ma

  • amateuramateurbeautiful girlSKMJred face girlyosukeSKMJ-245SKMJ245h-1324skmj00245
    • 2022-01-14
    120 min

    MEYD-733 The Wife Of The Female Teacher Ntr Grade Chief Went To Preview A School Trip With The Vice-Principal Teacher... Tsukino Runa

  • tsukino lunacreampiesingle workMEYDtameike gororyo inugamiMEYD-733MEYD733meyd00733
    • 2022-01-14
    120 min

    PPPE-002 I'Ll Reverse Confinement M Man For 24 Hours Until It Becomes Ji ● Pobaka Erina

  • erinabig titsslutPPPEoppaiPPPE-002PPPE002pppe00002
    • 2022-01-15
    114 min

    MRHP-004 When I Watched Av At A Loud Volume, A Big Ass Beautiful Wife Who Lives In The House Next Door Pushed To Make A Complaint. A Frustrated Married Woman Is In Estrus On My Erection Ji ● Po And Reverse Squeezed! I Was Decided To Be Kept As A Raw

  • shinoda yucreampiesingle workMRHPmisesu no sugao emmanuelleichiro yumisakimarried assMRHP-004MRHP004mrhp00004
    • 2022-01-15
    130 min

    GVH-348 Mother And Child Fucking Ayaka Muto

  • ayaka mutocreampiemature womanGVHglory questtakahashi chitsujiGVH-348GVH348gvh00348
    • 2022-02-05
    150 min

    SCOP-756 My Sister Who Eated An Aphrodisiac That Looks Like Sweets Masturbates In Her Brother'S Room!! When I Noticed The Existence Of My Brother Who Was Peeping Into Me, Attacked Me By Ji ● Po, Drops Yodare, And Incest!!

  • amateursisterSCOPscoopk taromousouzokuSCOP-756SCOP756scop00756
    • 2022-02-19
    125 min

    MGMQ-088 Nozomi Arimura, An M Erogenous Clinic Where There Is A Genius S Slutty Nurse Who Does Anal Of A Man In The Hospital

  • arimura nozomianalslutMGMQmegamithe beautiful goddess queenMGMQ-088MGMQ088mgmq00088
    • 2022-02-19
    127 min

    GMEM-059 Ultra Sweet Akagai Innocent Pretty Guardian Kyoki Ranbu Gone Away Training ~ Small Devil Aphromeat Continuous Acme In Hell ~ Hikaru Minazuki

  • hikaru minazukibeautiful girlsingle workGMEMavs collectorbaba za babbyavscollector goldGMEM-059GMEM059gmem00059
    • 2022-02-19
    243 min

    NASH-646 I Can'T Stand It Until Night! The Best 4 Hours 3 Of A Fifty Mother Required By Her Son From Morning

  • amateurcreampiemature womanNASHnadeshikoNASH-646NASH646nash00646
    • 2022-02-26
    118 min

    MASM-001 The Niece Of A Damn Cheeky Female Brat Told Me That I Was An Adult And Gave In! A Story That Was Squeezed Reverse And Fell Into M Ichika Matsumoto

  • ichika matsumotocreampieuniformMASMkaguyahimept mousouzokuichiro yumisakimasochistic manMASM-001MASM001masm00001
    • 2022-03-18
    120 min

    JUL-900 Former Local Station Announcer Awakening Intertwining Sweat, Competing Lips, Passion Sex. Tanaka Nanami

  • tanaka nanamimature womansingle workJULmadonnamametaro mamezawaJUL-900JUL900jul00900
    • 2022-03-25
    480 min

    FIR-030 Real Gachi Nampa BEST PART. 15 Lots Of Local Girls I Got At 8 Locations Nationwide!

  • amateurcreampieamateurFIRprestigeprestige entertainmentFIR-030FIR030
    • 2022-03-24
    182 min

    NHDTB-645 A Chaste Wife Who Is Sitting By An Intruder Until It Is Completely Cum Shot With An Aphrodisiac Ji ○ Port And Is Squid So Much That Her Consciousness Flutters

  • amateurcreampiesquirtingNHDTBnatural highkansukeNHDTB-645NHDTB6451nhdtb00645
    • 2022-03-24
    128 min

    IENF-201 Do You Know Clearly The Number Of Wrinkles In Anal! No Mosaic Continuous Climax Anal Show Masturbation 9

  • yuki mishima mao watanabeanalIENFienergyienfIENF-201IENF2011ienf00201
    • 2022-04-02

    ORECO-033

  • amateurORECOmy amateur zoreco033oreco 033ORECO-033ORECO033
    • 2022-04-08

    MIUM-803

  • amateurMIUMprestige premiumprestige premiumMIUM-803MIUM803
    • 2022-04-08
    150 min

    JUL-926 With Mina, A Married Woman I Met At A Business Trip Men'S Esthetic... After Being Impatient With Teasing, I Had Dense Vaginal Cum Shot Sex Until The Gold Ball Was Empty... Kitano Mina

  • mina kitanocreampiebig titsJULmadonnacaptain orionJUL-926JUL926jul00926
    • 2022-04-08

    GNS-019

  • amateurGNSgooniesGNS-019GNS019
    • 2022-04-14

    SIRO-4800

  • amateurbig titsamateurSIROamateur tvSIRO-4800SIRO4800
    • 2022-04-14
    130 min

    MEKO-229 “Aunt Rental” Service Returns 17 I Wanted To Have More Amazing Sex With An Erotic And Gentle Aunt Who Will Secretly Let Me Have Vaginal Cum Shot Sex If You Ask, So I Tried To Replace

  • amateurcreampieamateurMEKOmature woman laboMEKO-229MEKO229h-1160meko00229



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free