TANF-003 Summer Vacation Sunburn Residue And Yukino-Chan'S Swimming Pool Class

SQTEAVSAAUKGCAWDNACRSPRDMEYDWAAASSNIVEMANNPJVENUCESDHODVNGODDASDCJODONEZMVSDAMBI
            154 min
Skip Ad

TANF-003 Summer Vacation Sunburn Residue And Yukino-Chan'S Swimming Pool Class

Views
1.435M
Release date :
2023-02-18
Length :
154 min
Models:
amateur
Categories :
beautiful girlpetitepovsunburnbeautiful breastsjavcensored4kdelusion groupjavcensoredhigh vision
Studio :
tanpopo mousozoku
Label :
furawa TANF 003 TANF003 TANF tanf00003
Description:
TANF-003 Summer Vacation Sunburn Residue And Yukino-Chan'S Swimming Pool Class Release date 2023-02-18 Length 154 min tanf00003 Director no ton Label furawa Studio tanpopo mousozoku ,amateur,jav, high vision, beautiful breasts, 4k, javcensored, sunburn, petite, censored, beautiful girl, delusion group, pov TANF-003 TANF003 TANF




2018-12-07
474 min

AST-063 Incest Age Fifty Mother Vaginal Cum Shot Second Volume 8 Hours

  • amateurcreampiemature womanASTrubysusumu yanokuchitreasure rupyAST-063AST063
    • 2018-11-17
    238 min

    TURA-371 I Used My Position As A Company Boss To Call My Subordinate'S Wife Who Was Stationed Overseas, Drink Tea With Sleeping Pills And Comatose, So I Will Post.

  • amateurcreampieTURAjukujo ha tsurai yoTURA-371TURA371
    • 2013-07-11
    120 min

    SKA-001 Shiro-Tosuki Manmusume Vol.1 Honoka Mayu

  • honoka mayuamateursingle workSKAprestigesuki ariSKA-001SKA001
    • 2019-03-17
    167 min

    NFD-021 Couples Swarming On Swap Sns 2 Near Kanto

  • amateuramateurmature womanNFDrubyjukunen nonfixNFD-021NFD021
    • 2019-02-15
    486 min

    MTM-001 Street Corner Amateur Pick-Up! Girls Bar Edition If You Want To Have A Drink And Drink, How Far Will It Go! ? 11 People 8 Hours Super Best Volume.1

  • amateuramateurMTMprestigemegatra maxMTM-001MTM001
    • 2012-08-19
    120 min

    SW-125 I Sprayed A Super Secret Ethnic Aphrodisiac Spray On A Beautiful Young Wife On A Full Bus, And Started Yoga By Killing My Voice In A Car That Could Not Move

  • amateurSWplumshirouto only plumSW-125SW125
    • 2019-04-19
    485 min

    MTM-003 Street Corner Amateur Pick-Up! Super Best Vol.03 Lunch Married Wife 12 People 8 Hours

  • amateuramateurMTMprestigemegatra maxMTM-003MTM003
    • 2019-01-20
    177 min

    NNPJ-317 I Found A God Waiting Busty Daughter Nao-Chan (G Cup) That I Found In A Dating System And Changed Into An Onahole! 7 Days Of Intense Cosplay Vaginal Cum Shot Every Day. Nampa Japan Express Vol.90

  • amateurcreampiebig titsNNPJnanpa japanNNPJ-317NNPJ317
    • 2018-10-25
    190 min

    FAA-280 Take The Arasa Woman Home From The Second Party Of The Wedding To The Home And Sneak A Shot! ! ! Faa-280

  • amateurFAAf aFAA-280FAA280
    • 2019-02-16
    162 min

    AP-633 Super Sensitive! Pre-Menstrual Girls Raw Nipple Kneading And Sexual Harassment Body Measurement

  • amateurcreampieschoolgirlAPapachekuniokahhh groupAP-633AP633
    • 2018-12-12
    129 min

    FONE-031 Because Of The Small Breasts Complex, I Took A Plane To Meet The Virgin Hakata Junjo Musume For 18 Years.

  • amateuramateurFONEfirst stardiscoveryFONE-031FONE031
    • 2018-12-14
    99 min

    VOSS-121 The Wife Who Was Longing To See On The Morning Crowded Train Had Encountered A Molester, But Instead Of Refusing, It Was A Molester Ok Wife Who Can Get Horny! I Knew It And Decided To Touch The First Challenge Of Molesting, "I'M Trembling ..

  • amateurcreampiebig titsVOSSvenussaruthe matures projectVOSS-121VOSS121
    • 2019-01-25
    480 min

    FSB-027 Guess'S Extreme Video Collection

  • amateurFSBprestigefullsail bestFSB-027FSB027
    • 2018-11-02
    481 min

    TRE-085 The Best Creampie Fuck With The Best Mistress. Best Vol.02 Contains 8 Works Of Fucking Fantasy With Two People Who Drown In Instinct And Pleasure.

  • amateurcreampieamateurTREprestigetreasureTRE-085TRE085
    • 2016-06-02
    238 min

    NANP-001 The Strongest Amateur Group In Tobu Tojo Line

  • amateuramateurNANPmercuryultimate pick upNANP-001NANP001
    • 2018-12-14
    238 min

    SIM-012 Imadoki Girls On Their Way Home From School Are Soaking Wet With Powerful Water Guns! The Blush And Excitement Are So Wet That The Nipples Float Through And Blush! ? I Felt So Excited By The Stimulation Of The Water Guns. ] Sex During Youth E

  • amateurcreampieschoolgirlSIMprestigeamateur pussiesSIM-012SIM012
    • 2018-11-20
    477 min

    EIH-031 Working Aunt Full Voyeur! ! I Forgot My Job And Sucked Into The Po, A Horny Amateur Gave Me A Nui! ! Part 2

  • amateuruniformmature womanEIHstar paradiseeight hEIH-031EIH031
    • 2012-11-23
    229 min

    SCOP-099 If A Beautiful Athlete On An Expedition Drinks An Aphrodisiac Stamina Drink, It Will Change! It Came Attacked By Trained The Body! !

  • amateuramateurSCOPscoopeightmousouzokuSCOP-099SCOP099
    • 2018-10-25
    145 min

    NHDTB-194 Solicited By An English School ... The Girl Who Was Addicted To The First Continuous Cum

  • amateurschoolgirlNHDTBnatural highhopeless dainanaNHDTB-194NHDTB194
    • 2018-10-12
    121 min

    SUPA-382 Tokyo Creampie School Girl Noa

  • amateurcreampiebig titsSUPAskyu shirotojohnny shibuyaSUPA-382SUPA382
    • 2014-01-21
    244 min

    YRH-030 Completely Negotiating! Aim For The Rumored Amateur Geki Leather Girl! Vol.08

  • amateuramateurbeautiful girlYRHprestigemuzina mannameteiyorozu honpoYRH-030YRH030
    • 2018-11-22
    235 min

    DANDY-633 “'What Do You Do With Excitement To Your Aunt'?” Special Youth In The Campground You Want To Show Off To Your Mom Friend!

  • amateurbig titsmature womanDANDYdandytenderloin nakamoriDANDY-633DANDY633
    • 2019-02-12
    135 min

    NINE-011 Brothers Eating Anime Voice Small Devil Carnivorous Sister Is Big Ass Monster Eimi

  • amateurbig titsslutNINEmercurychateaubriand hutNINE-011NINE011
    • 2018-10-27
    221 min

    CLUB-514 First Time With A Thick Dildo Body Vigorous Legs Hips Sensitive Oma ○ This Toro Toro Immediately Shy Masturbation Marunouchi Ol Hen

  • amateursquirtingCLUBhentai shinshi clubCLUB-514CLUB514



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free