ATID-602 Muscle Girl Yota'S M Influencer Muscle Girl Seems To Be Sexually Active In Front Of Her Manager (Boyfriend) Leaked Video!




AVSAMVSDVENXRBDCAWDFSDSSNACXBLKSPRDHMNATIDWAAASANSQTEGVHCESDHODVPPPDDTTADN
            170 min
Skip Ad

ATID-602 Muscle Girl Yota'S M Influencer Muscle Girl Seems To Be Sexually Active In Front Of Her Manager (Boyfriend) Leaked Video!

Views
2
Release date :
2024-06-28
Length :
170 min
Models:
chanyota
Categories :
high visionjavcensoredsingle workmusclejavdocumentaryprankcensoredathlete
Label :
ATID 602 ATID602 ATID atid00602
Description:
ATID-602 Muscle Girl Yota'S M Influencer Muscle Girl Seems To Be Sexually Active In Front Of Her Manager (Boyfriend) Leaked Video! Release date 2024-06-28 Length 170 min atid00602 ,chanyota,single work, high vision, prank, documentary, javcensored, jav, muscle, censored, athlete ATID-602 ATID602 ATID




2020-11-17
144 min

KUSE-002 Muscle Training You ○ Uber Chanyota Av Debut

  • amateursquirtingKUSEsod createanzothis actress style is amazingKUSE-002KUSE002
    • 2020-12-15
    137 min

    KUSE-003 Chanyota (25) Acme X Sex Size

  • chanyotasingle workKUSEsod createanzothis actress style is amazingKUSE-003KUSE003
    • 2021-01-12
    144 min

    KUSE-005 "Premature Ejaculation Can Be Cured By Muscle Training!" Gachinko Sex 4 Production Without Script * Cum Swallowing On Parade Of Muscular Skills Against Amateur Opponents # Chanyota Slut

  • chanyotahandjobsingle workKUSEsod createanzothis actress style is amazingKUSE-005KUSE005
    • 2021-02-02
    135 min

    SDMM-084 Screaming Blue Sky Splash With A Glans Blame Like A Butt! !! A Man'S First Squirting Challenge! !! Muscle You ● Uber Chanyota Slut Tech Reverse Nampa Sp Deadly! !! Gripping Man Tide Edition

  • chanyotaslutsingle workSDMMsod createzampamagic mirrorSDMM-084SDMM084
    • 2021-03-16
    132 min

    KUSE-008 30 Days Of Abstinence Release! Immediate Demon Piston! !! Fierce Cum! Surrounded 360 Degrees By My Favorite Ji ○ Port, Endless Metamorphosis Muscle Sexual Intercourse Lifted! Chanyota

  • chanyotasingle workKUSEsod createmid eyethis actress style is amazingKUSE-008KUSE008
    • 2021-04-13
    138 min

    KUSE-013 Physiologically Impossible! A New Female Teacher Of The Swimming Club Adviser Who Was Filled With Aphrodisiacs By The Vice-Principal Who Really Hates

  • chanyotasingle workdramaKUSEsod createryo inugamithis actress style is amazingKUSE-013KUSE013
    • 2021-06-08
    119 min

    SDDE-648 Geki Piston Limited Immediately Saddle Muscle Training Jim-Making A Beautiful Body Trained With Cum Squid-

  • chanyota tsujii honokasquirtingSDDEsod createdainanasenzSDDE-648SDDE648
    • 2021-06-24
    123 min

    KUSE-018 Active Muscle Training Beautiful Girl You ○ Uber First Raw Vaginal Cum Shot! I Tried To Hit The Real Sperm Directly In The Womb In A Powerful Position! !! Chanyota

  • chanyotacreampiesingle workKUSEsod createzampathis actress style is amazingKUSE-018KUSE018
    • 2021-08-26
    140 min

    KUSE-023 100cm Over Big Butt Girl In Butt Butt Butt Peach Source Town Customs Land Chanyota

  • chanyotasoloworkKUSEsod createjap kasaijoyuu no kuse ga sugoiKUSE-023KUSE023
    • 2021-09-23
    120 min

    KUSE-027 "I'm Going !!" I'm Going To Make A Muscular Girl Go With A Hard Piston Vaginal Cum Shot Sexual Intercourse! Chanyota

  • chanyotacreampiesoloworkKUSEsod createtaiga kosakaijoyuu no kuse ga sugoiKUSE-027KUSE027
    • 2021-11-25
    120 min

    SDMU-969 Infiltrated Drug Investigator Chanyota Who Was Pickled In Yak And Fucked In A Group

  • chanyotaSDMUdazai chinpodazai chinposod createSDMU-969SDMU969
    • 2022-01-13
    130 min

    SDMU-976 Abstinence M Man Amateur Only! Unlimited Vaginal Cum Shot Ok! !! Please Ejaculate As Much Sperm As You Like Sp! !! !! Chanyota

  • chanyotacreampieSDMUsod createk westSDMU-976SDMU976
    • 2022-03-24
    130 min

    SDMU-984 I Can't Forgive A Popular Female Gym Trainer Banning Me As A Guest! I'll Do What I Want With A Brainwashing Esthetic! Chanyota

  • takarada arisa chanyotaSDMUsod createmoroboshi ichitaroSDMU-984SDMU984
    • 2022-04-07
    105 min

    STARS-551 Geki Piston Limited Immediately Saddle Muscle Training Gym Beautiful Model Yuna Ogura-Making A Beautiful Body Trained With Cum Squid-

  • ogura yuna chanyotabeautiful girlSTARSsod createdainanasod starSTARS-551STARS551
    • 2022-12-23
    115 min

    THP-96 Super Heroine Close Call! ! Vol.96 Sailor Freesia Muscle Chanyota

  • chanyotasoloworkTHPgigasakata tooruTHP-96THP96
    • 2022-05-13
    160 min

    JUFE-391 Personal Trainer With Muscle Beauty Big Breasts Nice Body Is Addicted To Bare Libido Ji Po! Chanyota

  • chanyotacreampiesquirtingJUFEfitchJUFE-391JUFE391
    • 2022-06-10
    120 min

    BBAN-376 Two People With Tsubaki Rika & Chanyota Too Erotic Body Are Close Contact W Lesbian Lifted

  • tsubaki rika chanyotabig titslesbianBBANvivianBBAN-376BBAN376
    • 2022-06-17
    120 min

    JUFE-397 Revenge Porn! A Record That Made An Arrogant Muscle Female Trainer A Sex Slave In De S

  • chanyotacreampiebig titsJUFEfitchJUFE-397JUFE397
    • 2022-07-07
    138 min

    DRPT-019 Macho Manager Who Turned Into A Slutty Woman With A Protein Aphrodisiac That He Tricked Her Into Drinking During Training Camp Training Is A Shrimp Warp Cowgirl And Asks For Vaginal Cum Shot Many Times

  • chanyotasingle workDRPTasa kara strongDRPT-019DRPT019
    • 2022-07-07
    112 min

    IESM-065 Chanyota Bondage Ban Lifted Popular Y ● U T ● Ber'S First Bondage, Hanging, Hard Sm Training

  • chanyotacreampiesingle workIESMiesmkiku rinIESM-065IESM065
    • 2022-07-01
    120 min

    HZGD-225 Estrus Libido Muscle Influencer Muscle Training Temptation Cum Shot Sexual Intercourse

  • chanyotacreampiebig titsHZGDhitodzuma hanazono gekijouzampaHZGD-225HZGD225
    • 2022-07-09
    124 min

    REAL-802 Demon Ikase-Chan Yota

  • chanyotadeepthroatsingle workREALreal real workskaorudemon ikaseREAL-802REAL802
    • 2022-07-22
    95 min

    GHOV-52 Female Phantom Thief Of Justice Night Angel

  • chanyota shima kotoriGHOVgigasakata tooruGHOV-52GHOV52
    • 2022-08-11
    124 min

    IENF-228 Chanyota 45 Vaginal Cum Shot From Morning Till Night

  • chanyotacreampiesingle workIENFcream pie sex from morning till nightkiku rinienfIENF-228IENF228



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free