AKDL-217 A Humiliating Part-Time Job For Knee-Highs! Is It A Housework Agency College Student In The Absolute Domain Or Is It 20-Year-Old Yukari'S




STARSFSDSSEBODWAAASPRDSANMVSDADNMILKDASDNACRGVHAPODLULUSSISNACXSQTEATIDPPPDAUKS
            152 min
Skip Ad

AKDL-217 A Humiliating Part-Time Job For Knee-Highs! Is It A Housework Agency College Student In The Absolute Domain Or Is It 20-Year-Old Yukari'S

Views
1.384M
Release date :
2023-02-09
Length :
152 min
Models:
is it yukari s
Categories :
censoredknee socks4kjavsingle workfemale college studenthigh visionkiss kissdramajavcensored
Director :
akinori
Studio :
akinori
Label :
AKDL 217 AKDL217 AKDL 1akdl00217
Description:
AKDL-217 A Humiliating Part-Time Job For Knee-Highs! Is It A Housework Agency College Student In The Absolute Domain Or Is It 20-Year-Old Yukari'S Release date 2023-02-09 Length 152 min 1akdl00217 Director akinori Label amateur clover Studio akinori ,is it yukari s,knee socks, drama, 4k, kiss kiss, javcensored, single work, jav, high vision, female college student, censored AKDL-217 AKDL217 AKDL




2013-06-20
130 min

MIJPS-0033 The Old Soft Body Anymore! Impossible!Real!Hard Body!Rhythmic Gymnastics Day!Sawada Yukari

  • amateurMIJPSsugar worksmikihiko aokimister sugar worksMIJPS-0033MIJPS0033
    • 0000-00-00
    4 min

    UMD-33 This’ll Get Your Dick Hard! Skewered By Two Black Cocks – Japanese Beauties Ravished By

  • chisato shoda kaede niyamacreampiemature womanUMDglobal media entertainmentultra mixUMD-33UMD33
    • 0000-00-00
    4 min

    UMD-28 The Joy And Terror Of Being Violated By A Beast – Black Sexual Abuse Collection – 20 Babes

  • azusa nagasawa chisato shodamature womanUMDglobal media entertainmentultra mixUMD-28UMD28
    • 0000-00-00
    3 min

    OBA-03 10 Beautiful Mature Women Wild Orgies 4 Hour Collection

  • akari minamino erika hasemature womanOBAsalt pepperOBA-03OBA03
    • 2011-12-05
    118 min

    SW-075 When I Invite You To My Room With An Excuse To Dry Clothes That I Met In The Evening With An Unrequited Female Employee In The Evening, I'M A Gingin With My Naked Shirt And Fluffy Boobs And All-Around Panchira!

  • sora no yume yukari akariSWswitchtocchiswitch switchSW-075SW075
    • 2012-09-07
    480 min

    KMDS-00097 8 hours 10 MILF POV Chau was to continue with the interview

  • niio kiriko takei yukarimarried womanmature womanKMDSkamata eizobentenKMDS-00097KMDS00097
    • 2013-05-30
    120 min

    TNSS-87 Yukari Seno Mother Yosoji Pervert Incest Relatives Pies

  • seno yukaricreampiemature womanTNSScenter villagejuro amakasutonan shappeTNSS-87TNSS87
    • 2013-01-10
    120 min

    BEBE-17 Yukari Mitsui Black Cum Milf

  • mitsui yukaricreampiemarried womanBEBEcenter villagesareo takatsukakurobutoBEBE-17BEBE17
    • 2015-10-25
    120 min

    MAC-34 Families With A Son Of The Spear Want Prime Watch Out! ?the Moment The Son Commit A Mother! !

  • tsukamoto chikako koyanagi yukaricreampiemature womanMACglobal media entertainmentmother childMAC-34MAC34
    • 2015-10-09
    150 min

    SERO-0291 After 20 Minutes Begun Undressing Trump Tournament With Unyielding A Sister, The Last Battle I To Migurumi Stripped The Sister Betting Blowjob / SEX / Cum! !We Also Eliminated The Chagrin Challenge ... To

  • asagiri akari uno yukaricreampiebig titsSEROeroticaSERO-0291SERO0291
    • 2013-12-12
    100 min

    LUNE-06 Dedication Nursing Orihara Yukari Nursemaid Mother

  • orihara yukarimarried womansoloworkLUNEcenter villagemanjuro momojihona zonoLUNE-06LUNE06
    • 2017-06-15
    139 min

    SDEN-005 The Lascivious Lady Jk And Cum Shot Group Orgy Launch Unlimited! 30 Genuine Vaginal Cum Shot (※ 12 Amateur Men Participate)

  • azuki yukari miyazawaschoolgirlSDENsod createzampaentrySDEN-005SDEN005
    • 2012-06-28
    100 min

    SKSS-65 Yukari Orihara bathtub incest mother Pies

  • orihara yukarisoloworkmature womanSKSScenter villagejuro amakasushunkashuto center bridgeSKSS-65SKSS65
    • 2013-05-02
    110 min

    EUUD-07 Business Trip!I Was Forced To Give In To A Single Man To Deliver Soap MILF Yukari Seno

  • seno yukaricreampiemarried womanEUUDcenter villagehiroshi setagayajurakuEUUD-07EUUD07
    • 0000-00-00
    1 min

    RBD-11 Bondage Cuckoldry. I Was Forced Into Breaking In Training By My Neighbor. Yukari Orihara

  • yukari oriharabig titsRBDglobal media entertainmentkairose butlerRBD-11RBD11
    • 2013-08-01
    128 min

    SS-020 When Av Actress Comes To The Shooting Site, Suddenly Sex Cum Shot Ss-020

  • anri okita maki koizumicreampiebig titsSSglory questSS-020SS020
    • 2009-04-09
    75 min

    SOUL-11 My Mother Incest Plump Female Teacher Female Teacher Nasty

  • orihara yukaribig titsmature womanSOULcenter villageshiontamashiSOUL-11SOUL11
    • 0000-00-00
    1 min

    RBD-12 Family in Bondage Stepmom Judged by Son Yukari Kirishima , 52

  • yukari kirishimabig titsmature womanRBDglobal media entertainmentkairose butlerRBD-12RBD12
    • 2011-10-08
    119 min

    SW-060 When I Suddenly Put On A Sailor Suit And Left It In The Street For A Popular Mature Woman, I Wanted To Get Excited About The Shame Play

  • miki mizusawa shizuka kannomature womanSWplumshirouto only plumSW-060SW060
    • 2012-09-10
    120 min

    BDD-15 35-year-old Yukari Orihara Six Huge Black Cock VS

  • orihara yukaricreampiebig titsBDDglobal media entertainmentabashirikkablack dickBDD-15BDD15
    • 2013-10-17
    115 min

    SS-025 Busty Yoga Instructor Creampie Sex Lesson 2

  • mikuni maisaki yukari nakaatsucreampiebig titsSSplumSS-025SS025
    • 2016-02-11
    90 min

    NUKA-15 Frustration Of Mother And Unequaled Son Out In A Three-shot Of Without Disconnecting Yukari Orihara

  • orihara yukaricreampiebig titsNUKAcenter villagekotaro misatozegu center villageNUKA-15NUKA15
    • 0000-00-00
    4 min

    UMD-22 Thrusted By Violent Huge Cocks! Exposed! Black Simulated Rape. 20 Raped Beauties. The

  • ayano murasaki azusa nagasawamature womanUMDglobal media entertainmentultra mixUMD-22UMD22
    • 2016-04-08
    120 min

    UMD-536 Man Of Tsu Squirting Continuous Ejaculation And Ejaculation After The Glans Accused Fascinating Technique! !Trouble And Got Desugi! !This Is A Rumor (fuckable) Rejuvenated Massage 2

  • uno yukari wakatsuki miinacreampiesquirtingUMDleodoragon nishikawaUMD-536UMD536



    • Jav censored, jav uncensored, jav streaming, watch javhd free, jav xxx, japanese adult videos free